Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Homeobox protein CDX-1 |
|---|
Gene and Protein Information
| Gene ID | 1044 |
|---|---|
| Uniprot Accession IDs | P47902 Q4VAU4 Q9NYK8 |
| Ensembl ID | ENSP00000231656 |
| Family | Belongs to the Caudal homeobox family. |
| Sequence | MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 471693 | CDX1 | caudal type homeobox 1 | 9598 | VGNC:11880 | OMA, EggNOG |
| Mouse | 12590 | Cdx1 | caudal type homeobox 1 | 10090 | MGI:88360 | Inparanoid, OMA, EggNOG |
| Dog | 612256 | CDX1 | caudal type homeobox 1 | 9615 | VGNC:39084 | Inparanoid, OMA, EggNOG |
| Pig | 100626275 | CDX1 | caudal type homeobox 1 | 9823 | OMA, EggNOG | |
| Opossum | 100024158 | CDX1 | caudal type homeobox 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 395397 | CDX1 | caudal type homeobox 1 | 9031 | CGNC:4232 | OMA, EggNOG |
| Anole lizard | 100564110 | cdx1 | caudal type homeobox 1 | 28377 | Inparanoid, EggNOG | |
| Xenopus | 395055 | cdx1 | caudal type homeobox 1 | 8364 | XB-GENE-485396 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein CDX-1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein CDX-1
protein / nucleic acid binding / DNA binding protein / Homeobox protein CDX-1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein CDX-1
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein CDX-1
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein CDX-1
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.