🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

RCE1

DescriptionCAAX prenyl protease 2

Gene and Protein Information

Gene ID9986
Uniprot Accession IDs Q9Y256 Q52LZ9
Ensembl ID ENSP00000309163
Symbole FACE2 RCE1A RCE1B FACE2 RCE1A RCE1B
FamilyBelongs to the peptidase U48 family.
Sequence
MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp451355RCE1Ras converting CAAX endopeptidase 19598VGNC:1027OMA, EggNOG
Macaque713224RCE1Ras converting CAAX endopeptidase 19544Inparanoid, OMA, EggNOG
Mouse19671Rce1Ras converting CAAX endopeptidase 110090MGI:1336895Inparanoid, OMA, EggNOG
Rat309153Rce1Ras converting CAAX endopeptidase 110116RGD:1309261Inparanoid, OMA, EggNOG
Dog483705RCE1Ras converting CAAX endopeptidase 19615Inparanoid, EggNOG
Horse100052803RCE1Ras converting CAAX endopeptidase 19796VGNC:22270Inparanoid, OMA, EggNOG
Cow539539RCE1Ras converting CAAX endopeptidase 19913VGNC:33828Inparanoid, OMA, EggNOG
Pig100514389RCE1Ras converting CAAX endopeptidase 19823Inparanoid, OMA, EggNOG
Opossum100015109RCE1Ras converting CAAX endopeptidase 113616Inparanoid, OMA, EggNOG
Anole lizard100556866rce1Ras converting CAAX endopeptidase 128377Inparanoid, OMA, EggNOG
Xenopus549000rce1Ras converting CAAX endopeptidase 18364XB-GENE-979449Inparanoid, OMA, EggNOG
Zebrafish557720rce1aRas converting CAAX endopeptidase 1a7955ZDB-GENE-041008-116Inparanoid, OMA, EggNOG
C. elegans3565253fce-2CAAX prenyl protease 2 homolog6239Inparanoid, OMA, EggNOG
Fruitfly44002Srasseveras7227FBgn0029121Inparanoid, OMA, EggNOG
S.cerevisiae855317RCE1CAAX prenyl protease4932S000004887Inparanoid, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.