Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Cyclin-dependent kinase 7 |
|---|
Gene and Protein Information
| Gene ID | 1022 |
|---|---|
| Uniprot Accession IDs | P50613 Q9BS60 Q9UE19 |
| Ensembl ID | ENSP00000256443 |
| Symbole | CAK CAK1 CDKN7 MO15 STK1 CAK CAK1 HCAK MO15 STK1 CDKN7 p39MO15 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462378 | CDK7 | cyclin dependent kinase 7 | 9598 | VGNC:11877 | OMA, EggNOG |
| Macaque | 699871 | CDK7 | cyclin dependent kinase 7 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12572 | Cdk7 | cyclin-dependent kinase 7 | 10090 | MGI:102956 | Inparanoid, OMA, EggNOG |
| Rat | 171150 | Cdk7 | cyclin-dependent kinase 7 | 10116 | RGD:621124 | Inparanoid, OMA |
| Dog | 608441 | CDK7 | cyclin dependent kinase 7 | 9615 | VGNC:39060 | Inparanoid, OMA, EggNOG |
| Horse | 100049964 | CDK7 | cyclin dependent kinase 7 | 9796 | VGNC:16355 | Inparanoid, OMA, EggNOG |
| Cow | 515462 | CDK7 | cyclin dependent kinase 7 | 9913 | VGNC:27134 | Inparanoid, OMA, EggNOG |
| Pig | 100310797 | CDK7 | cyclin dependent kinase 7 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100019498 | CDK7 | cyclin dependent kinase 7 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100074988 | CDK7 | cyclin dependent kinase 7 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 771294 | CDK7 | cyclin dependent kinase 7 | 9031 | CGNC:10969 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557869 | cdk7 | cyclin dependent kinase 7 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549973 | cdk7 | cyclin-dependent kinase 7 | 8364 | XB-GENE-485507 | Inparanoid, OMA, EggNOG |
| Zebrafish | 405897 | cdk7 | cyclin-dependent kinase 7 | 7955 | ZDB-GENE-010320-2 | Inparanoid, OMA, EggNOG |
| C. elegans | 171784 | cdk-7 | Cyclin-dependent kinase 7 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 31441 | Cdk7 | Cyclin-dependent kinase 7 | 7227 | FBgn0263237 | Inparanoid, EggNOG |
| S.cerevisiae | 851450 | KIN28 | TFIIH complex serine/threonine-protein kinase subunit KIN28 | 4932 | S000002266 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.