Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Hippocalcin-like protein 1 |
|---|
Gene and Protein Information
| Gene ID | 3241 |
|---|---|
| Uniprot Accession IDs | P37235 Q969S5 |
| Ensembl ID | ENSP00000483786 |
| Symbole | BDR1 BDR1 HLP2 VILIP-3 |
| Family | Belongs to the recoverin family. |
| Sequence | MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459026 | HPCAL1 | hippocalcin like 1 | 9598 | VGNC:6392 | Inparanoid, OMA, EggNOG |
| Macaque | 695395 | HPCAL1 | hippocalcin like 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 53602 | Hpcal1 | hippocalcin-like 1 | 10090 | MGI:1855689 | Inparanoid, OMA, EggNOG |
| Rat | 50871 | Hpcal1 | hippocalcin-like 1 | 10116 | RGD:708375 | Inparanoid, OMA, EggNOG |
| Dog | 609787 | HPCAL1 | hippocalcin like 1 | 9615 | VGNC:41768 | Inparanoid, OMA, EggNOG |
| Horse | 100057077 | HPCAL1 | hippocalcin like 1 | 9796 | VGNC:49466 | Inparanoid, OMA, EggNOG |
| Cow | 513870 | HPCAL1 | hippocalcin like 1 | 9913 | VGNC:29937 | Inparanoid, OMA, EggNOG |
| Opossum | 100027949 | HPCAL1 | hippocalcin like 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 396161 | HPCAL1 | hippocalcin like 1 | 9031 | CGNC:49679 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567837 | hpcal1 | hippocalcin like 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 733484 | hpcal1 | hippocalcin-like 1 | 8364 | XB-GENE-947040 | Inparanoid, OMA |
| Zebrafish | 393696 | hpca | hippocalcin | 7955 | ZDB-GENE-040426-1683 | Inparanoid, OMA, EggNOG |
| Fruitfly | 40186 | Nca | Neurocalcin | 7227 | FBgn0013303 | OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.