Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | RanBP-type and C3HC4-type zinc finger-containing protein 1 |
|---|
Gene and Protein Information
| Gene ID | 10616 |
|---|---|
| Uniprot Accession IDs | Q9BYM8 O95623 Q86SL2 Q96BS3 Q9BYM9 |
| Ensembl ID | ENSP00000348632 |
| Symbole | C20orf18 RNF54 UBCE7IP3 XAP3 XAP4 XAP3 XAP4 HOIL1 PBMEI PGBM1 RBCK2 RNF54 HOIL-1 ZRANB4 C20orf18 UBCE7IP3 |
| Family | Belongs to the RBR family. |
| Sequence | MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458025 | RBCK1 | RANBP2-type and C3HC4-type zinc finger containing 1 | 9598 | VGNC:9966 | OMA, EggNOG |
| Macaque | 714692 | RBCK1 | RANBP2-type and C3HC4-type zinc finger containing 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 24105 | Rbck1 | RanBP-type and C3HC4-type zinc finger containing 1 | 10090 | MGI:1344372 | Inparanoid, OMA, EggNOG |
| Rat | 60383 | Rbck1 | RANBP2-type and C3HC4-type zinc finger containing 1 | 10116 | RGD:708404 | Inparanoid, OMA |
| Dog | 485818 | RBCK1 | RANBP2-type and C3HC4-type zinc finger containing 1 | 9615 | VGNC:45397 | Inparanoid, OMA, EggNOG |
| Horse | 100067987 | RBCK1 | RANBP2-type and C3HC4-type zinc finger containing 1 | 9796 | VGNC:51596 | Inparanoid, OMA, EggNOG |
| Cow | 504400 | RBCK1 | RANBP2-type and C3HC4-type zinc finger containing 1 | 9913 | VGNC:33776 | OMA, EggNOG |
| Opossum | 100011102 | RBCK1 | RANBP2-type and C3HC4-type zinc finger containing 1 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100562899 | rbck1 | RANBP2-type and C3HC4-type zinc finger containing 1 | 28377 | Inparanoid, OMA | |
| Zebrafish | 569903 | shrprbck1r | sharpin and rbck1 related | 7955 | ZDB-GENE-080220-52 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / ligase / ubiquitin-protein ligase / RanBP-type and C3HC4-type zinc finger-containing protein 1
protein / ligase / ubiquitin-protein ligase / RanBP-type and C3HC4-type zinc finger-containing protein 1
DTO Classes
protein / Enzyme / Ligase / Ubiquitin-protein ligase / RanBP-type and C3HC4-type zinc finger-containing protein 1
protein / Enzyme / Ligase / Ubiquitin-protein ligase / RanBP-type and C3HC4-type zinc finger-containing protein 1
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.