🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

IL10RB

DescriptionInterleukin-10 receptor subunit beta

Gene and Protein Information

Gene ID3588
Uniprot Accession IDs Q08334 Q9BUU4 IL-10 receptor subunit beta
Ensembl ID ENSP00000290200
Symbole CRFB4 D21S58 D21S66 CRFB4 CRF2-4 D21S58 D21S66 CDW210B IL-10R2
FamilyBelongs to the type II cytokine receptor family.
Sequence
MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp473966LOC473966interleukin-10 receptor subunit beta9598OMA, EggNOG
Mouse16155Il10rbinterleukin 10 receptor, beta10090MGI:109380Inparanoid, OMA, EggNOG
Rat304091Il10rbinterleukin 10 receptor subunit beta10116RGD:1560373Inparanoid, OMA, EggNOG
Dog100856489IL10RBinterleukin 10 receptor subunit beta9615Inparanoid, EggNOG
Horse100052549IL10RBinterleukin 10 receptor subunit beta9796OMA, EggNOG
Cow767864IL10RBinterleukin 10 receptor subunit beta9913Inparanoid, OMA, EggNOG
Opossum100026691IL10RBinterleukin 10 receptor subunit beta13616OMA, EggNOG
Anole lizard103281134LOC103281134interleukin-10 receptor subunit beta28377OMA, EggNOG
Zebrafish797527crfb4cytokine receptor family member b47955ZDB-GENE-070905-3OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    type II cytokine receptor    /    Interleukin-10 receptor subunit beta
protein    /    receptor    /    defense/immunity protein    /    Interleukin-10 receptor subunit beta
protein    /    receptor    /    type I cytokine receptor    /    Interleukin-10 receptor subunit beta
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Type II cytokine receptor    /    Interleukin-10 receptor subunit beta

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpécificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.