🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

MESP2

DescriptionMesoderm posterior protein 2

Gene and Protein Information

Gene ID145873
Uniprot Accession IDs Q0VG99 Q7RTU2
Ensembl ID ENSP00000342392
Symbole BHLHC6 SCDO2 SCDO2 bHLHc6
Sequence
MAQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETLRLAIRYIGHLSAVLGLSEESLQCRRRQRGDAGSPWGCPLCPDRGPAEAQTQAEGQGQGQGQGQGQGQGQGQGQGQGQGQGRRPGLVSAVLAEASWGSPSACPGAQAAPERLGRGVHDTDPWATPPYCPKIQSPPYSSQGTTSDASLWTPPQGCPWTQSSPEPRNPPVPWTAAPATLELAAVYQGLSVSPEPCLSLGAPSLLPHPSCQRLQPQTPGRCWSHSAEVVPNSEDQGPGAAFQLSEASPPQSSGLRFSGCPELWQEDLEGARLGIFY
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp467757MESP2mesoderm posterior bHLH transcription factor 29598VGNC:1920OMA, EggNOG
Macaque701003MESP2mesoderm posterior bHLH transcription factor 29544Inparanoid, OMA, EggNOG
Mouse17293Mesp2mesoderm posterior 210090MGI:1096325Inparanoid, OMA, EggNOG
Rat293046Mesp2mesoderm posterior bHLH transcription factor 210116RGD:1305959Inparanoid, OMA, EggNOG
Dog100683170MESP2mesoderm posterior bHLH transcription factor 29615VGNC:43164Inparanoid, OMA, EggNOG
Cow615145MESP2mesoderm posterior bHLH transcription factor 29913VGNC:53945Inparanoid, OMA, EggNOG
Pig100153433MESP2mesoderm posterior bHLH transcription factor 29823OMA, EggNOG
Opossum100015370MESP2mesoderm posterior bHLH transcription factor 213616Inparanoid, EggNOG
Zebrafish58069mespaamesoderm posterior aa7955ZDB-GENE-000406-8Inparanoid, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.