Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Integral membrane protein 2B |
|---|
Gene and Protein Information
| Gene ID | 9445 |
|---|---|
| Uniprot Accession IDs | Q9Y287 Q5W0A3 Q96B24 Q9NYH1 |
| Ensembl ID | ENSP00000367828 |
| Symbole | BRI BRI2 BRI FBD ABRI BRI2 E25B E3-16 RDGCA imBRI2 BRICD2B |
| Family | Belongs to the ITM2 family. |
| Sequence | MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452714 | ITM2B | integral membrane protein 2B | 9598 | VGNC:5071 | Inparanoid, OMA, EggNOG |
| Macaque | 709896 | ITM2B | integral membrane protein 2B | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16432 | Itm2b | integral membrane protein 2B | 10090 | MGI:1309517 | Inparanoid, OMA, EggNOG |
| Rat | 290364 | Itm2b | integral membrane protein 2B | 10116 | RGD:620727 | Inparanoid, OMA, EggNOG |
| Dog | 476916 | ITM2B | integral membrane protein 2B | 9615 | VGNC:42150 | Inparanoid, OMA, EggNOG |
| Horse | 100050288 | ITM2B | integral membrane protein 2B | 9796 | VGNC:19191 | Inparanoid, OMA, EggNOG |
| Cow | 510575 | ITM2B | integral membrane protein 2B | 9913 | VGNC:30340 | Inparanoid, OMA, EggNOG |
| Pig | 595120 | ITM2B | integral membrane protein 2B | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100022655 | ITM2B | integral membrane protein 2B | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100078532 | ITM2B | integral membrane protein 2B | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 395969 | ITM2B | integral membrane protein 2B | 9031 | CGNC:12758 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567836 | itm2b | integral membrane protein 2B | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394850 | itm2b | integral membrane protein 2B | 8364 | XB-GENE-986226 | Inparanoid, OMA, EggNOG |
| Zebrafish | 323632 | itm2ba | integral membrane protein 2Ba | 7955 | ZDB-GENE-030131-2352 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.