🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

GPR31

Description12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor

Gene and Protein Information

Gene ID2853
Uniprot Accession IDs O00270 B0M0K2 Q4VBL3 Q9NQ20 12-(S)-HETE receptor
Ensembl ID ENSP00000355799
Symbole HETER HETER1 12-HETER
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp472189GPR31G protein-coupled receptor 319598VGNC:2849OMA, EggNOG
Mouse436440Gpr31bG protein-coupled receptor 31, D17Leh66b region10090MGI:1354372Inparanoid, OMA, EggNOG
Rat292310Gpr31G protein-coupled receptor 3110116RGD:1305187Inparanoid, OMA, EggNOG
Dog484081GPR31G protein-coupled receptor 319615VGNC:41430Inparanoid, OMA, EggNOG
Horse100055116GPR31G protein-coupled receptor 319796VGNC:18539Inparanoid, OMA, EggNOG
Cow617303GPR31G protein-coupled receptor 319913VGNC:29582Inparanoid, OMA, EggNOG
Opossum100032621GPR31G protein-coupled receptor 3113616Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.