Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Transmembrane protease serine 2 |
|---|
Gene and Protein Information
| Gene ID | 7113 |
|---|---|
| Uniprot Accession IDs | O15393 A8K6Z8 B2R8E5 B7Z459 D3DSJ2 F8WES1 Q6GTK7 Q9BXX1 |
| Ensembl ID | ENSP00000381588 |
| Symbole | PRSS10 PP9284 PRSS10 |
| Family | Belongs to the peptidase S1 family. |
| Sequence | MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 474007 | TMPRSS2 | transmembrane serine protease 2 | 9598 | VGNC:3729 | OMA, EggNOG |
| Macaque | 715138 | TMPRSS2 | transmembrane protease, serine 2 | 9544 | OMA, EggNOG | |
| Mouse | 50528 | Tmprss2 | transmembrane protease, serine 2 | 10090 | MGI:1354381 | Inparanoid, OMA, EggNOG |
| Rat | 156435 | Tmprss2 | transmembrane serine protease 2 | 10116 | RGD:620766 | Inparanoid, OMA, EggNOG |
| Dog | 487770 | TMPRSS2 | transmembrane serine protease 2 | 9615 | VGNC:53045 | Inparanoid, OMA, EggNOG |
| Horse | 100058498 | TMPRSS2 | transmembrane serine protease 2 | 9796 | VGNC:24341 | Inparanoid, OMA, EggNOG |
| Cow | 511037 | TMPRSS2 | transmembrane serine protease 2 | 9913 | VGNC:36140 | Inparanoid, OMA, EggNOG |
| Opossum | 100016391 | TMPRSS2 | transmembrane protease, serine 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 418528 | TMPRSS2 | transmembrane protease, serine 2 | 9031 | CGNC:12069 | Inparanoid, OMA |
| Anole lizard | 100552320 | tmprss2 | transmembrane protease, serine 2 | 28377 | Inparanoid, OMA | |
| Zebrafish | 494080 | tmprss2 | transmembrane serine protease 2 | 7955 | ZDB-GENE-041212-48 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.