Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Lymphokine-activated killer T-cell-originated protein kinase |
|---|
Gene and Protein Information
| Gene ID | 55872 |
|---|---|
| Uniprot Accession IDs | Q96KB5 B4DX68 D3DST2 Q9NPD9 Q9NYL7 Q9NZK6 |
| Ensembl ID | ENSP00000428489 |
| Symbole | TOPK SPK CT84 TOPK HEL164 Nori-3 |
| Family | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily. |
| Sequence | MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464496 | PBK | PDZ binding kinase | 9598 | VGNC:825 | OMA, EggNOG |
| Macaque | 713242 | PBK | PDZ binding kinase | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 52033 | Pbk | PDZ binding kinase | 10090 | MGI:1289156 | Inparanoid, OMA, EggNOG |
| Rat | 290326 | Pbk | PDZ binding kinase | 10116 | RGD:1309565 | Inparanoid, OMA, EggNOG |
| Dog | 477371 | PBK | PDZ binding kinase | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100060789 | PBK | PDZ binding kinase | 9796 | VGNC:21182 | Inparanoid, OMA, EggNOG |
| Cow | 534781 | PBK | PDZ binding kinase | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100141310 | PBK | PDZ binding kinase | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | 100077802 | PBK | PDZ binding kinase | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 422003 | PBK | PDZ binding kinase | 9031 | CGNC:12423 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100565867 | pbk | PDZ binding kinase | 28377 | OMA, EggNOG | |
| Xenopus | 496810 | pbk | PDZ binding kinase | 8364 | XB-GENE-1017083 | Inparanoid, OMA, EggNOG |
| Zebrafish | 360218 | pbk | PDZ binding kinase | 7955 | ZDB-GENE-030523-2 | Inparanoid, OMA, EggNOG |
| Fruitfly | 32753 | CG8173 | CG8173 gene product from transcript CG8173-RA | 7227 | FBgn0030864 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.