224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | G-protein coupled receptor 35 |
|---|
Gene and Protein Information
| Gene ID | 2859 |
|---|---|
| Uniprot Accession IDs | Q9HC97 J3KR30 O43495 Q17R58 Q4VBN5 Q4ZFV2 Q6FHI8 Q86UH4 |
| Ensembl ID | ENSP00000411788 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460070 | GPR35 | G protein-coupled receptor 35 | 9598 | VGNC:1951 | OMA, EggNOG |
| Macaque | 699073 | GPR35 | G protein-coupled receptor 35 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 64095 | Gpr35 | G protein-coupled receptor 35 | 10090 | MGI:1929509 | Inparanoid, OMA, EggNOG |
| Rat | 367315 | Gpr35 | G protein-coupled receptor 35 | 10116 | RGD:1309404 | Inparanoid, OMA, EggNOG |
| Dog | 100855802 | LOC100855802 | G-protein coupled receptor 35-like | 9615 | OMA, EggNOG | |
| Horse | GPR35 | G protein-coupled receptor 35 [Source:HGNC Symbol;Acc:HGNC:4492] | 9796 | OMA, EggNOG | ||
| Cow | 505056 | GPR35 | G protein-coupled receptor 35 | 9913 | VGNC:29584 | Inparanoid, OMA, EggNOG |
| Opossum | 100021803 | LOC100021803 | G-protein coupled receptor 35-like | 13616 | OMA, EggNOG | |
| Platypus | 100080746 | GPR35 | G protein-coupled receptor 35 | 9258 | OMA, EggNOG | |
| Anole lizard | 100557680 | gpr35 | G protein-coupled receptor 35 | 28377 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 35
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 35
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.