Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Sentrin-specific protease 8 |
|---|
Gene and Protein Information
| Gene ID | 123228 |
|---|---|
| Uniprot Accession IDs | Q96LD8 Q96QA4 |
| Ensembl ID | ENSP00000340505 |
| Symbole | DEN1 NEDP1 PRSC2 DEN1 NEDP1 PRSC2 |
| Family | Belongs to the peptidase C48 family. |
| Sequence | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 697613 | SENP8 | SUMO/sentrin peptidase family member, NEDD8 specific | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 71599 | Senp8 | SUMO/sentrin specific peptidase 8 | 10090 | MGI:1918849 | Inparanoid, OMA, EggNOG |
| Rat | 315723 | Senp8 | SUMO peptidase family member, NEDD8 specific | 10116 | RGD:1309955 | Inparanoid, OMA, EggNOG |
| Dog | 487631 | SENP8 | SUMO peptidase family member, NEDD8 specific | 9615 | VGNC:46008 | Inparanoid, OMA, EggNOG |
| Horse | 100052291 | SENP8 | SUMO peptidase family member, NEDD8 specific | 9796 | VGNC:22826 | Inparanoid, OMA, EggNOG |
| Cow | 782385 | LOC782385 | sentrin-specific protease 8 | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100625525 | SENP8 | SUMO/sentrin peptidase family member, NEDD8 specific | 9823 | OMA, EggNOG | |
| Opossum | 100013705 | SENP8 | SUMO/sentrin peptidase family member, NEDD8 specific | 13616 | Inparanoid, EggNOG | |
| Platypus | 100079737 | SENP8 | SUMO/sentrin peptidase family member, NEDD8 specific | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | SENP8 | SUMO/sentrin peptidase family member, NEDD8 specific [Source:HGNC Symbol;Acc:HGNC:22992] | 28377 | Inparanoid, OMA, EggNOG | ||
| Zebrafish | 565126 | senp8 | SUMO peptidase family member, NEDD8 specific | 7955 | ZDB-GENE-060929-1186 | OMA, EggNOG |
| C. elegans | 3565434 | ulp-3 | Ubiquitin-Like Protease | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 36339 | Den1 | Deneddylase 1 | 7227 | FBgn0033716 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.