🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

SCN2B

DescriptionSodium channel subunit beta-2

Gene and Protein Information

Gene ID6327
Uniprot Accession IDs O60939 O75302 Q9UNN3
Ensembl ID ENSP00000278947
Symbole ATFB14
FamilyBelongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.
Sequence
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque678698SCN2Bsodium voltage-gated channel beta subunit 29544Inparanoid, OMA, EggNOG
Mouse72821Scn2bsodium channel, voltage-gated, type II, beta10090MGI:106921Inparanoid, OMA, EggNOG
Rat25349Scn2bsodium voltage-gated channel beta subunit 210116RGD:3633Inparanoid, OMA, EggNOG
Dog403485SCN2Bsodium voltage-gated channel beta subunit 29615VGNC:45917Inparanoid, OMA, EggNOG
Horse100062848SCN2Bsodium voltage-gated channel beta subunit 29796VGNC:22735Inparanoid, OMA, EggNOG
Cow538722SCN2Bsodium voltage-gated channel beta subunit 29913VGNC:34348Inparanoid, OMA, EggNOG
Pig100514594SCN2Bsodium voltage-gated channel beta subunit 29823OMA, EggNOG
Opossum100025272SCN2Bsodium voltage-gated channel beta subunit 213616Inparanoid, OMA, EggNOG
Chicken419776SCN2Bsodium voltage-gated channel beta subunit 29031CGNC:14499OMA, EggNOG
Anole lizard100560156scn2bsodium voltage-gated channel beta subunit 228377Inparanoid, OMA, EggNOG
Xenopus100144663scn2bsodium voltage-gated channel beta subunit 28364XB-GENE-921739Inparanoid, OMA, EggNOG
Zebrafish777666scn2bsodium channel, voltage-gated, type II, beta7955ZDB-GENE-070920-1Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transporter    /    cell adhesion molecule    /    Sodium channel subunit beta-2
protein    /    transporter    /    voltage-gated sodium channel    /    Sodium channel subunit beta-2
protein    /    transporter    /    sodium channel    /    Sodium channel subunit beta-2
protein    /    transporter    /    voltage-gated ion channel    /    Sodium channel subunit beta-2
DTO Classes
protein    /    Ion channel    /    Sodium channel auxiliary subunit 1-4 (sca-) family    /    SCN2B family    /    Sodium channel subunit beta-2

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.