🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

SCTR

DescriptionSecretin receptor

Gene and Protein Information

Gene ID6344
Uniprot Accession IDs P47872 Q12961 Q13213 Q53T00 SCT-R
Ensembl ID ENSP00000019103
Symbole SR
FamilyBelongs to the G-protein coupled receptor 2 family.
Sequence
MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp459576SCTRsecretin receptor9598VGNC:2810OMA, EggNOG
Macaque695182SCTRsecretin receptor9544Inparanoid, OMA, EggNOG
Mouse319229Sctrsecretin receptor10090MGI:2441720Inparanoid, OMA, EggNOG
Rat81779Sctrsecretin receptor10116RGD:621342Inparanoid, OMA, EggNOG
Dog483883SCTRsecretin receptor9615VGNC:45934Inparanoid, OMA, EggNOG
Horse100051620SCTRsecretin receptor9796VGNC:51491Inparanoid, OMA, EggNOG
Cow523291SCTRsecretin receptor9913VGNC:34370Inparanoid, OMA, EggNOG
Pig100521045SCTRsecretin receptor9823Inparanoid, EggNOG
Opossum100013364SCTRsecretin receptor13616Inparanoid, OMA, EggNOG
Chicken770943SCTRsecretin receptor9031CGNC:9179Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class B secretin like    /    Glucagon receptor    /    Secretin receptor

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.