Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Phospholipid hydroperoxide glutathione peroxidase |
|---|
Gene and Protein Information
| Gene ID | 2879 |
|---|---|
| Uniprot Accession IDs | P36969 O43381 Q6PJ59 Q9UPK2 PHGPx |
| Ensembl ID | ENSP00000346103 |
| Symbole | MCSP SMDS GPx-4 PHGPx snGPx GSHPx-4 snPHGPx |
| Family | Belongs to the glutathione peroxidase family. |
| Sequence | MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741876 | GPX4 | glutathione peroxidase 4 | 9598 | VGNC:2549 | Inparanoid, OMA, EggNOG |
| Mouse | 625249 | Gpx4 | glutathione peroxidase 4 | 10090 | MGI:104767 | Inparanoid, OMA, EggNOG |
| Rat | 29328 | Gpx4 | glutathione peroxidase 4 | 10116 | RGD:69226 | Inparanoid, OMA, EggNOG |
| Zebrafish | 352928 | gpx4a | glutathione peroxidase 4a | 7955 | ZDB-GENE-030410-2 | Inparanoid, OMA |
| C. elegans | 187630 | gpx-2 | Glutathione peroxidase | 6239 | Inparanoid, OMA | |
| Fruitfly | 38413 | PHGPx | CG12013 gene product from transcript CG12013-RC | 7227 | FBgn0035438 | Inparanoid, EggNOG |
| S.cerevisiae | 852546 | GPX2 | glutathione peroxidase GPX2 | 4932 | S000000448 | OMA, EggNOG |
| S.cerevisiae | 853842 | GPX1 | glutathione peroxidase GPX1 | 4932 | S000001509 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / oxidoreductase / peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
protein / oxidoreductase / peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
protein / Enzyme / Oxidoreductase / Peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.