224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Taste receptor type 2 member 20 |
|---|
Gene and Protein Information
| Gene ID | 259295 |
|---|---|
| Uniprot Accession IDs | P59543 P59549 Q2HIZ4 Q496D8 Q645X9 |
| Ensembl ID | ENSP00000441624 |
| Symbole | TAS2R49 T2R20 T2R49 T2R56 TAS2R49 |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence | MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLWVILLHWYSTVLNPTSSNLKVIIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHHLKRKAKSVVLVIVLGSLFFLVCHLVMKHTYINVWTEECEGNVTWKIKLRNAMHLSNLTVAMLANLIPFTLTLISFLLLIYSLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAIYFLCLIISFWNFKMRPKEIVLMLCQAFGIIYPSFHSFILIWGNKTLKQTFLSVLWQVTCWAKGQNQSTP Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 493898 | TAS2R20 | taste 2 receptor member 20 | 9598 | VGNC:13478 | Inparanoid, OMA |
| Rat | 690448 | Tas2r120 | taste receptor, type 2, member 120 | 10116 | RGD:1596060 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 20
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 20
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.