Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Taste receptor type 2 member 40 |
|---|
Gene and Protein Information
| Gene ID | 259286 |
|---|---|
| Uniprot Accession IDs | P59535 A4D2I2 Q645W6 T2R40 |
| Ensembl ID | ENSP00000386210 |
| Symbole | GPR60 GPR60 T2R40 T2R58 |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence | MATVNTDATDKDISKFKVTFTLVVSGIECITGILGSGFITAIYGAEWARGKTLPTGDRIMLMLSFSRLLLQIWMMLENIFSLLFRIVYNQNSVYILFKVITVFLNHSNLWFAAWLKVFYCLRIANFNHPLFFLMKRKIIVLMPWLLRLSVLVSLSFSFPLSRDVFNVYVNSSIPIPSSNSTEKKYFSETNMVNLVFFYNMGIFVPLIMFILAATLLILSLKRHTLHMGSNATGSRDPSMKAHIGAIKATSYFLILYIFNAIALFLSTSNIFDTYSSWNILCKIIMAAYPAGHSVQLILGNPGLRRAWKRFQHQVPLYLKGQTL Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472611 | TAS2R40 | taste 2 receptor member 40 | 9598 | VGNC:8774 | Inparanoid, OMA, EggNOG |
| Macaque | 706077 | TAS2R40 | taste 2 receptor member 40 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 387515 | Tas2r144 | taste receptor, type 2, member 144 | 10090 | MGI:2681312 | Inparanoid, OMA, EggNOG |
| Rat | 500101 | Tas2r144 | taste receptor, type 2, member 144 | 10116 | RGD:1562314 | Inparanoid, OMA, EggNOG |
| Dog | 608842 | TAS2R40 | taste 2 receptor member 40 | 9615 | VGNC:47119 | Inparanoid, OMA, EggNOG |
| Horse | 100050534 | TAS2R40 | taste 2 receptor member 40 | 9796 | VGNC:23883 | Inparanoid, OMA, EggNOG |
| Cow | 785133 | TAS2R40 | taste 2 receptor member 40 | 9913 | VGNC:35614 | OMA, EggNOG |
| Pig | 106508195 | TAS2R40 | taste 2 receptor member 40 | 9823 | OMA, EggNOG | |
| Opossum | 664679 | T2R40 | bitter taste receptor Modo-T2R40 | 13616 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 40
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 40
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.