Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Trace amine-associated receptor 5 |
|---|
Gene and Protein Information
| Gene ID | 9038 |
|---|---|
| Uniprot Accession IDs | O14804 D8KZS1 Q2M1V1 Q4VBL1 Q5VUQ3 Q6NTA8 TaR-5 |
| Ensembl ID | ENSP00000258034 |
| Symbole | PNR PNR |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVSYFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLSQWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSACNPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472128 | TAAR5 | trace amine associated receptor 5 | 9598 | VGNC:3719 | Inparanoid, OMA, EggNOG |
| Macaque | 709325 | TAAR5 | trace amine associated receptor 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 215854 | Taar5 | trace amine-associated receptor 5 | 10090 | MGI:2685073 | Inparanoid, OMA, EggNOG |
| Rat | 294123 | Taar5 | trace amine-associated receptor 5 | 10116 | RGD:1359185 | Inparanoid, OMA, EggNOG |
| Dog | 483989 | TAAR5 | trace amine associated receptor 5 | 9615 | VGNC:47059 | Inparanoid, OMA, EggNOG |
| Horse | 100073122 | TAAR5 | trace amine-associated receptor 5 | 9796 | OMA, EggNOG | |
| Horse | 100073108 | LOC100073108 | trace amine-associated receptor 5-like | 9796 | Inparanoid, OMA | |
| Cow | 509368 | TAAR5 | trace amine associated receptor 5 | 9913 | VGNC:35554 | Inparanoid, OMA, EggNOG |
| Pig | 100152802 | TAAR5 | trace amine associated receptor 5 | 9823 | OMA, EggNOG | |
| Opossum | 100031228 | TAAR5 | trace amine associated receptor 5 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 768558 | TAAR5 | trace amine associated receptor 5 | 9031 | CGNC:10461 | Inparanoid, OMA |
| Anole lizard | 100553785 | taar5 | trace amine associated receptor 5 | 28377 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Trace amine-associated receptor 5
protein / G-protein coupled receptor / Class A rhodopsin like / Trace amine-associated receptor 5
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.