Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Tumor protein p53-inducible nuclear protein 1 |
|---|
Gene and Protein Information
| Gene ID | 94241 |
|---|---|
| Uniprot Accession IDs | Q96A56 B2RCE5 Q969R9 |
| Ensembl ID | ENSP00000344215 |
| Symbole | P53DINP1 SIP SIP Teap p53DINP1 TP53DINP1 TP53INP1A TP53INP1B |
| Sequence | MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739304 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 9598 | VGNC:777 | OMA, EggNOG |
| Macaque | TP53INP1 | tumor protein p53-inducible nuclear protein 1 [Source:RefSeq peptide;Acc:NP_001253509] | 9544 | Inparanoid, OMA, EggNOG | ||
| Mouse | 60599 | Trp53inp1 | transformation related protein 53 inducible nuclear protein 1 | 10090 | MGI:1926609 | Inparanoid, OMA, EggNOG |
| Rat | 297822 | Tp53inp1 | tumor protein p53 inducible nuclear protein 1 | 10116 | RGD:631423 | OMA, EggNOG |
| Dog | 611710 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 9615 | VGNC:47725 | Inparanoid, OMA, EggNOG |
| Horse | 100055346 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 9796 | VGNC:24423 | Inparanoid, OMA, EggNOG |
| Cow | 782667 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 9913 | VGNC:36236 | Inparanoid, OMA, EggNOG |
| Opossum | 100022681 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100081400 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100563989 | tp53inp1 | tumor protein p53 inducible nuclear protein 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100490057 | tp53inp1 | tumor protein p53 inducible nuclear protein 1 | 8364 | XB-GENE-959922 | Inparanoid, OMA, EggNOG |
| Zebrafish | 568021 | tp53inp1 | tumor protein p53 inducible nuclear protein 1 | 7955 | ZDB-GENE-031018-3 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.