🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

TACSTD2

DescriptionTumor-associated calcium signal transducer 2

Gene and Protein Information

Gene ID4070
Uniprot Accession IDs P09758 Q15658 Q6FG48 Q7Z7Q4 Q96QD2
Ensembl ID ENSP00000360269
Symbole GA733-1 M1S1 TROP2 EGP1 GP50 M1S1 EGP-1 TROP2 GA7331 GA733-1
FamilyBelongs to the EPCAM family.
Sequence
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp456890TACSTD2tumor associated calcium signal transducer 29598OMA, EggNOG
Macaque716334TACSTD2tumor associated calcium signal transducer 29544Inparanoid, OMA, EggNOG
Mouse56753Tacstd2tumor-associated calcium signal transducer 210090MGI:1861606Inparanoid, OMA, EggNOG
Rat494343Tacstd2tumor-associated calcium signal transducer 210116RGD:1359498Inparanoid, OMA, EggNOG
Cow539853TACSTD2tumor associated calcium signal transducer 29913VGNC:35563Inparanoid, OMA, EggNOG
Pig100510966TACSTD2tumor associated calcium signal transducer 29823OMA, EggNOG
Opossum100032064TACSTD2tumor associated calcium signal transducer 213616Inparanoid, OMA, EggNOG
Anole lizardTACSTD2tumor associated calcium signal transducer 2 [Source:HGNC Symbol;Acc:HGNC:11530]28377Inparanoid, OMA, EggNOG
Xenopus496567epcamepithelial cell adhesion molecule8364XB-GENE-986667OMA, EggNOG
Zebrafish406454epcamepithelial cell adhesion molecule7955ZDB-GENE-040426-2209Inparanoid, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.