ELOVL3

DescriptionElongation of very long chain fatty acids protein 3

Gene and Protein Information

Gene ID83401
Uniprot Accession IDs Q9HB03 Q5VZL3 Q8N180
Ensembl ID ENSP00000359022
Symbole CIG30 CIG30 CIG-30
FamilyBelongs to the ELO family. ELOVL3 subfamily.
Sequence
MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp745450ELOVL3ELOVL fatty acid elongase 39598VGNC:7275OMA, EggNOG
Macaque712927ELOVL3ELOVL fatty acid elongase 39544Inparanoid, OMA, EggNOG
Mouse12686Elovl3elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 310090MGI:1195976Inparanoid, OMA, EggNOG
Rat309449Elovl3ELOVL fatty acid elongase 310116RGD:1307263Inparanoid, OMA, EggNOG
Dog486855ELOVL3ELOVL fatty acid elongase 39615VGNC:40321Inparanoid, OMA, EggNOG
Horse100060081ELOVL3ELOVL fatty acid elongase 39796VGNC:17539Inparanoid, OMA, EggNOG
Cow539782ELOVL3ELOVL fatty acid elongase 39913VGNC:28449Inparanoid, OMA, EggNOG
Pig100155434ELOVL3ELOVL fatty acid elongase 39823Inparanoid, OMA, EggNOG
Opossum100029282ELOVL3ELOVL fatty acid elongase 313616Inparanoid, EggNOG
Platypus100080155ELOVL3ELOVL fatty acid elongase 39258Inparanoid, OMA, EggNOG
C. elegans183948elo-3Putative fatty acid elongation protein 36239Inparanoid, OMA
S.cerevisiae853243ELO1fatty acid elongase ELO14932S000003732Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transferase    /    acyltransferase    /    Elongation of very long chain fatty acids protein 3
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acyltransferase    /    Elongation of very long chain fatty acids protein 3

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.