224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Thioredoxin |
|---|
Gene and Protein Information
| Gene ID | 7295 |
|---|---|
| Uniprot Accession IDs | P10599 B1ALW1 O60744 Q53X69 Q96KI3 Q9UDG5 Trx |
| Ensembl ID | ENSP00000363641 |
| Symbole | TRDX TRX TRX1 TRX TRDX TRX1 |
| Family | Belongs to the thioredoxin family. |
| Sequence | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 740248 | TXN | thioredoxin | 9598 | VGNC:4894 | OMA, EggNOG |
| Macaque | 712587 | TXN | thioredoxin | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 22166 | Txn1 | thioredoxin 1 | 10090 | MGI:98874 | Inparanoid, OMA, EggNOG |
| Rat | 116484 | Txn1 | thioredoxin 1 | 10116 | RGD:621157 | OMA, EggNOG |
| Horse | 100033827 | TXN | thioredoxin | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 280950 | TXN | thioredoxin | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 397581 | TXN | thioredoxin | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | 100076650 | LOC100076650 | thioredoxin-like | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 396437 | TXN | thioredoxin | 9031 | CGNC:49804 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100560936 | LOC100560936 | thioredoxin | 28377 | OMA, EggNOG | |
| Xenopus | 100170420 | loc100170420 | MGC80314 protein | 8364 | XB-GENE-5909791 | Inparanoid, OMA, EggNOG |
| Zebrafish | 336637 | zgc:56493 | zgc:56493 | 7955 | ZDB-GENE-030131-8581 | Inparanoid, OMA, EggNOG |
| C. elegans | 189905 | trx-4 | Thioredoxin | 6239 | OMA, EggNOG | |
| S.cerevisiae | 850732 | TRX1 | thioredoxin TRX1 | 4932 | S000004033 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.