Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Mitochondrial import receptor subunit TOM34 |
|---|
Gene and Protein Information
| Gene ID | 10953 |
|---|---|
| Uniprot Accession IDs | Q15785 Q53GH9 Q6IBN7 Q9NTZ3 hTom34 |
| Ensembl ID | ENSP00000361900 |
| Symbole | URCC3 TOM34 URCC3 HTOM34P |
| Family | Belongs to the Tom34 family. |
| Sequence | MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458274 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9598 | VGNC:6285 | Inparanoid, OMA, EggNOG |
| Mouse | 67145 | Tomm34 | translocase of outer mitochondrial membrane 34 | 10090 | MGI:1914395 | Inparanoid, OMA, EggNOG |
| Rat | 311621 | Tomm34 | translocase of outer mitochondrial membrane 34 | 10116 | RGD:1309029 | Inparanoid, OMA |
| Dog | 477239 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9615 | VGNC:49628 | Inparanoid, OMA, EggNOG |
| Horse | 100070847 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9796 | VGNC:50511 | Inparanoid, OMA, EggNOG |
| Cow | 508142 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9913 | VGNC:49135 | Inparanoid, OMA, EggNOG |
| Pig | 100157194 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | TOMM34 | translocase of outer mitochondrial membrane 34 [Source:HGNC Symbol;Acc:HGNC:15746] | 13616 | Inparanoid, EggNOG | ||
| Chicken | 419188 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9031 | CGNC:3015 | Inparanoid, OMA |
| Anole lizard | 100561170 | tomm34 | translocase of outer mitochondrial membrane 34 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 323361 | tomm34 | translocase of outer mitochondrial membrane 34 | 7955 | ZDB-GENE-030131-2081 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.