224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Selenoprotein F |
|---|
Gene and Protein Information
| Gene ID | 9403 |
|---|---|
| Uniprot Accession IDs | O60613 A0A0B4J1S4 Q4GZG7 Q8WU00 Q9BS64 Q9GZW0 Q9NR01 |
| Ensembl ID | ENSP00000328729 |
| Symbole | SEP15 SEP15 |
| Family | Belongs to the selenoprotein M/F family. |
| Sequence | MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 93684 | Selenof | selenoprotein F | 10090 | MGI:1927947 | OMA, EggNOG |
| Pig | 100038009 | SELENOF | selenoprotein F | 9823 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 352923 | selenof | selenoprotein F | 7955 | ZDB-GENE-030327-1 | Inparanoid, OMA |
| Fruitfly | 39969 | CG7484 | CG7484 gene product from transcript CG7484-RB | 7227 | FBgn0036745 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.