Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Sigma non-opioid intracellular receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 10280 |
|---|---|
| Uniprot Accession IDs | Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 |
| Ensembl ID | ENSP00000277010 |
| Symbole | OPRS1 SRBP SRBP ALS16 DSMA2 OPRS1 SR-BP SIG-1R SR-BP1 sigma1R hSigmaR1 |
| Family | Belongs to the ERG2 family. |
| Sequence | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 465062 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9598 | VGNC:10120 | OMA, EggNOG |
| Macaque | 700469 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18391 | Sigmar1 | sigma non-opioid intracellular receptor 1 | 10090 | MGI:1195268 | Inparanoid, OMA, EggNOG |
| Rat | 29336 | Sigmar1 | sigma non-opioid intracellular receptor 1 | 10116 | RGD:68364 | Inparanoid, OMA, EggNOG |
| Dog | 481587 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9615 | VGNC:46170 | Inparanoid, OMA, EggNOG |
| Horse | SIGMAR1 | sigma non-opioid intracellular receptor 1 [Source:HGNC Symbol;Acc:HGNC:8157] | 9796 | OMA, EggNOG | ||
| Cow | 538903 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9913 | VGNC:34619 | Inparanoid, OMA, EggNOG |
| Opossum | 100028812 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 100859748 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9031 | CGNC:63401 | Inparanoid, OMA |
| Anole lizard | 100551557 | sigmar1 | sigma non-opioid intracellular receptor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 393952 | sigmar1 | sigma non-opioid intracellular receptor 1 | 7955 | ZDB-GENE-040426-1006 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 855242 | ERG2 | C-8 sterol isomerase ERG2 | 4932 | S000004815 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.