SIGMAR1

DescriptionSigma non-opioid intracellular receptor 1

Gene and Protein Information

Gene ID10280
Uniprot Accession IDs Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0
Ensembl ID ENSP00000277010
Symbole OPRS1 SRBP SRBP ALS16 DSMA2 OPRS1 SR-BP SIG-1R SR-BP1 sigma1R hSigmaR1
FamilyBelongs to the ERG2 family.
Sequence
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp465062SIGMAR1sigma non-opioid intracellular receptor 19598VGNC:10120OMA, EggNOG
Macaque700469SIGMAR1sigma non-opioid intracellular receptor 19544Inparanoid, OMA, EggNOG
Mouse18391Sigmar1sigma non-opioid intracellular receptor 110090MGI:1195268Inparanoid, OMA, EggNOG
Rat29336Sigmar1sigma non-opioid intracellular receptor 110116RGD:68364Inparanoid, OMA, EggNOG
Dog481587SIGMAR1sigma non-opioid intracellular receptor 19615VGNC:46170Inparanoid, OMA, EggNOG
HorseSIGMAR1sigma non-opioid intracellular receptor 1 [Source:HGNC Symbol;Acc:HGNC:8157]9796OMA, EggNOG
Cow538903SIGMAR1sigma non-opioid intracellular receptor 19913VGNC:34619Inparanoid, OMA, EggNOG
Opossum100028812SIGMAR1sigma non-opioid intracellular receptor 113616Inparanoid, OMA, EggNOG
Chicken100859748SIGMAR1sigma non-opioid intracellular receptor 19031CGNC:63401Inparanoid, OMA
Anole lizard100551557sigmar1sigma non-opioid intracellular receptor 128377Inparanoid, OMA, EggNOG
Zebrafish393952sigmar1sigma non-opioid intracellular receptor 17955ZDB-GENE-040426-1006Inparanoid, OMA, EggNOG
S.cerevisiae855242ERG2C-8 sterol isomerase ERG24932S000004815Inparanoid, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.