🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

TNFRSF8

DescriptionTumor necrosis factor receptor superfamily member 8

Gene and Protein Information

Gene ID943
Uniprot Accession IDs P28908 B1AN79 B9EGD9 D3YTD8 Q6P4D9
Ensembl ID ENSP00000263932
Symbole CD30 D1S166E CD30 Ki-1 D1S166E
Sequence
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp457960TNFRSF8TNF receptor superfamily member 89598VGNC:7012OMA, EggNOG
Macaque722773TNFRSF8TNF receptor superfamily member 89544OMA, EggNOG
Mouse21941Tnfrsf8tumor necrosis factor receptor superfamily, member 810090MGI:99908Inparanoid, OMA, EggNOG
Rat25069Tnfrsf8TNF receptor superfamily member 810116RGD:3879Inparanoid, OMA, EggNOG
Dog487438TNFRSF8TNF receptor superfamily member 89615VGNC:47667Inparanoid, OMA, EggNOG
Horse100055885TNFRSF8TNF receptor superfamily member 89796VGNC:24373Inparanoid, OMA, EggNOG
Cow614780TNFRSF8TNF receptor superfamily member 89913VGNC:36170Inparanoid, OMA, EggNOG
Pig100737399TNFRSF8TNF receptor superfamily member 89823OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.