Annexin V-PE-Cy7

Cat. No.: rp226059
Disponible para pedir
GRADE & PURITY BioReagent ? BioReagent grade — tested suitable for life-science and molecular-biology use. Use for cell culture, assays, and biochemical work needing biological compatibility. Biological Stain ? Biological stain grade — dyes characterized for staining cells and tissues. Use in histology and microscopy where staining consistency matters. for Microscopy ? Microscopy grade — reagents/stains suited to sample prep and imaging. Use in microscopy where clarity and low background are needed. Suitable for Immunofluorescence(IF) ? IF grade — validated for immunofluorescence with low background staining. Use to localize targets in cells/tissue by fluorescence microscopy. 5 μL/test
Accession #
P08758
Protein Tag
No tag
Expression system
E. coli
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
25T
rp226059-25T
3
121,90US$
100T
rp226059-100T
2
339,90US$
300T
rp226059-300T
2
679,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

BioReagent, Biological Stain, for microscopy, Suitable for Immunofluorescence(IF), 5 μL/test Biological Stain,BioReagent,for Microscopy,Suitable for Immunofluorescence(IF) for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at 2-8°C,Protected from light,Do not freeze Ships Wet ice,Do not freeze Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Background information

Annexins are a family of calcium-dependent phospholipid-binding proteins that preferentially bind phosphatidylserine (PS). Under normal physiologic conditions, PS is predominantly located in the inner leaflet of the plasma membrane. Upon initiation of apoptosis, PS loses its asymmetric distribution across the phospholipid bilayer and is translocated to the extracellular membrane leaflet marking cells as targets of phagocytosis. Once on the outer surface of the membrane, PS can be detected by fluorescently labeled Annexin V in a calcium-dependent manner.

In early-stage apoptosis, the plasma membrane excludes viability dyes such as propidium iodide (PI), 7-AAD. These cells will stain with Annexin V but not a viability dye, thus distinguishing cells in early apoptosis. However, in late stage apoptosis, the cell membrane loses integrity thereby allowing Annexin V to also access PS in the interior of the cell. A viability dye can be used to resolve these late-stage apoptotic and necrotic cells (Annexin V, viability dye-positive) from the early-stage apoptotic cells (Annexin V positive, viability dye-negative).

We offer recombinant Annexin V conjugated to a numerous fluorophores, as well as an Annexin V biotin conjugate which can be detected with fluorophore-labeled streptavidin. By binding to PS, fluorophores labeled Annexin V can be used to detect and quantify apoptotic cells via flow cytometry or fluorescence microscopy. The excitation and emission maxima of the Annexin V conjugates are summarized in the following table. The excitation and emission maxima of the Annexin V conjugates are summarized in the following table.

Cat.No.Ex/Em (nm)Format
rp226056NABiotin
rp225999401/422AF405
rp226057490/525AF488
rp226060650/668AF647
rp226002681/704AF680
rp226003752/776AF750
rp226053498/517FITC
rp226004410/455Pacific Blue
rp226006647/665Cy5
rp226054650/660APC
rp226055565/575PE
rp226058565/670PE-Cy5
rp226059565/774PE-Cy7

Precautions

1. Please try to avoid light when using to slow down the quenching of fluorescence.

2. Propidium Iodide Solution is toxigenic and mutagenic; handle with care.

3. Due to the calcium dependence of the Annexin V:PS interaction, it is critical to avoid buffers containing EDTA or other calcium chelators during Annexin V experiments.

Instruction for use

1. Dilute 10X Binding Buffer (A1372288) to 1X using distilled water (1 mL 10X Binding Buffer + 9 mL ddH2O).

2. Wash cells twice with cold PBS and then resuspend the desired amounts of cells in Annexin V Binding Buffer at a concentration of 1.0-5.0 x 106 cells/mL.

3. Add 5 µL of Annexin V-PE-Cy7 to 100 µL of the cell suspension. Stain with a viability dye, such as PI (P1373641; P1372285), 7-AAD (A1372406), or DAPI (D1372407) dyes, if desired.

4. Gently vortex the cells and incubate for 10 min at RT (25°C) in the dark.

5. Add 100 µL of 1X Binding Buffer to each assay. Analyze by flow cytometry within 1 hr.

Specifications

Product Name
Annexin V-PE-Cy7
Sinónimos
Anchorin CII | Annexin 5 | Annexin A5 | Annexin V | Annexin-5 | Annexin5 | AnnexinA5 | AnnexinV | ANX 5 | ANX A5 | ANX5 | ANXA5 | ANXA5_HUMAN | Calphobindin I | CBP-I | Endonexin I | ENX 2 | ENX2 | Lipocortin V | PAP I | PAP-I | Placental anticoagulant pr
Grado
Biological Stain, BioReagent, for Microscopy, Suitable for Immunofluorescence(IF)
Especificaciones y pureza
BioReagent, Biological Stain, for microscopy, Suitable for Immunofluorescence(IF), 5 μL/test
Mecanismos bioquímicos y fisiológicos
The placental anticoagulant protein Annexin A5 (ANXA5) is a multifunctional protein that is highly expressed on the apical surfaces of syncytiotrophoblasts, and plays an important role in haemostatic regulations, maintaining blood fluidity of the placenta
Bioactividad
Testing in progress
Aminoácidos
2-320 aa
Secuencia
AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Conjugación
PE-Cy7
Excitación (nm)
Blue Laser(488nm), Green Laser(532nm), Yellow-Green Laser(561nm)
Emisión (nm)
774nm
Ex/Em(nm)
Número de adhesión
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
5 μL/test
Condiciones de almacenamiento de almacenamiento
Store at 2-8°C,Protected from light,Do not freeze
Enviado en
Wet ice,Do not freeze
Estabilidad y almacenamiento
The antibody solution should be stored undiluted between 2°C and 8°C, and protected from prolonged exposure to light. Do not freeze.
Imágenes

Annexin V-PE-Cy7 (rp226059) - Flow Cytometry
U937 cells were either untreated (left) or treated (right) with 5µM camptothecin (C111281) for 4 hours, then stained with Annexin V-PE-Cy7 (rp226059) in Annexin V Binding buffer (A1372288) for 10 minutes at room temperature.

Annexin V-PE-Cy7 (rp226059) - Flow Cytometry
U937 cells were either untreated (blue) or treated (red) with 5µM camptothecin (C111281) for 4 hours, then stained with Annexin V-PE-Cy7 (rp226059) in Annexin V Binding buffer (A1372288) for 10 minutes at room temperature.

Aplicación
AplicaciónDilution info
Flow Cytometry

5 μL/test; 

For flow cytometric staining, the suggested use of this reagent is 5 µL per 100,000 - million cells in a 100 µL volume of Annexin V Binding Buffer. It

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0926683Certificate of AnalysisJun 15, 2026 rp226059
ZJ25F0926684Certificate of AnalysisJun 15, 2026 rp226059
ZJ25F0926685Certificate of AnalysisJun 15, 2026 rp226059
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.