Recombinant Human BCMA/TNFRSF17 Protein

Cat. No.: rp169554
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
Q6PE46
Protein Tag
C-hFc
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human BCMA/TNFRSF17 Protein (rp169554) at 0.5 μg/mL can bind Belantamab (anti-TNFRSF17) (Ab170526) with the EC50 of 22.0 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp169554-10μg
≥10
111,90US$
50μg
rp169554-50μg
10
279,90US$
100μg
rp169554-100μg
10
439,90US$
1mg
rp169554-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Fc tag,PBS Only,≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,Fc tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Protein Function:
BCMA, B cell maturation antigen, is a member of the TNF receptor superfamily. It has been designated TNFRSF17. BCMA is a type III membrane protein containing one extracellular cysteine rich domain. Within the TNFRSF, it shares the highest homology with TACI. BCMA and TACI have both been shown to bind to APRIL and BAFF, members of the TNF ligand superfamily. BCMA expression has been found in immune organs and mature B cell lines. Although some expression has been observed at the cell surface, BCMA appears to be localized to the Golgi compartment. The binding of BCMA to APRIL or BAFF has been shown to stimulate IgM production in peripheral blood B cells and increase the survival of cultured B cells. This data suggests that BCMA may play an important role in B cell development, function and regulation. Human BCMA is a 184 amino acid (aa) protein consisting of a 54 aa extracellular domain, a 23 aa transmembrane domain, and a 107 aa intracellular domain. Mouse and human BCMA share 62% amino acid identity.

Specifications

Product Name
Recombinant Human BCMA/TNFRSF17 Protein
Sinónimos
B cell maturation antigen | B-cell maturation protein | BCMA | BCMAtumor necrosis factor receptor superfamily member 17 | BCMB-cell maturation factor | CD269 antigen | CD269 | TNFRSF13A | TNFRSF17 | tumor necrosis factor receptor superfamily, member 17,
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, Fc tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Fc tag, PBS Only, ≥90%(SDS-PAGE)
Bioactividad
Immobilized Recombinant Human BCMA/TNFRSF17 Protein (rp169554) at 0.5 μg/mL can bind Belantamab (anti-TNFRSF17) (Ab170526) with the EC50 of 22.0 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-54 aa
Secuencia
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Etiqueta proteínica
C-Fc
Número de adhesión
Peso molecular previsto
34.3 kDa
SDS-PAGE
34.0-44.3 kDa, under reducing conditions; 57.0-90.2 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human BCMA/TNFRSF17 Protein (rp169554) - ELISA
Immobilized Recombinant Human BCMA/TNFRSF17 Protein (rp169554) at 0.5 μg/mL can bind Belantamab (anti-TNFRSF17) (Ab170526) with the EC50 of 22.0 ng/mL.

Recombinant Human BCMA/TNFRSF17 Protein (rp169554) - SDS-PAGE
3 μg/lane of Recombinant Human BCMA/TNFRSF17 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 34.0-44.3 kDa under reducing conditions and 57.0-90.2 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0707634Certificate of AnalysisFeb 11, 2026 rp169554
ZJ24F0707635Certificate of AnalysisFeb 11, 2026 rp169554
ZJ24F0707636Certificate of AnalysisFeb 11, 2026 rp169554
ZJ24R0600640Certificate of AnalysisJun 10, 2024 rp169554
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.