Recombinant Human BID Protein

Cat. No.: rp183602
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. ≥95%(SDS-PAGE)
Accession #
P55957
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human BID Protein (rp183602) at 2.0 μg/mL can bind Recombinant Human Bcl-XL Protein (rp209934) with the EC50 of 261.4 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp183602-10μg
7
139,90US$
50μg
rp183602-50μg
3
399,90US$
100μg
rp183602-100μg
3
629,90US$
1mg
rp183602-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.899,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Bioactive, Carrier Free, ≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human BID Protein
Sinónimos
apoptic death agonist | BH3 interacting domain death agonist | BH3-interacting domain death agonist | BID isoform ES(1b) | BID isoform L(2) | BID isoform Si6 | BID | desmocollin type 4 | FP497 | Human BID coding sequence | MGC15319 | MGC42355 | p22 BID |
Grado
ActiBioPure™, Bioactive, Carrier Free
Especificaciones y pureza
ActiBioPure™, Bioactive, Carrier Free, ≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
BID is a 195 amino acid member of the Bcl-2 family of proteins that regulates outer mitochondrial membrane permeability. BID is a pro‑apoptotic member that causes cytochrome c to be released from the mitochondria intermembrane space into the cytosol. In h
Bioactividad
Immobilized Recombinant Human BID Protein (rp183602) at 2.0 μg/mL can bind Recombinant Human Bcl-XL Protein (rp209934) with the EC50 of 261.4 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
2-195 aa
Secuencia
DCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Número de adhesión
Peso molecular previsto
21.9 kDa
SDS-PAGE
19.3 kDa, under reducing conditions; 19.3 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human BID Protein (rp183602) - Binding Activity
Immobilized Recombinant Human BID Protein (rp183602) at 2.0 μg/mL can bind Recombinant Human Bcl-XL Protein (rp209934) with the EC ₅₀ of 261.4 ng/mL.

Recombinant Human BID Protein (rp183602) - SDS-PAGE
3 μg/lane of Recombinant Human BID Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 19.3 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1113646Certificate of AnalysisJun 15, 2026 rp183602
ZJ24F1113647Certificate of AnalysisJun 15, 2026 rp183602
ZJ24F1113648Certificate of AnalysisJun 15, 2026 rp183602
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View Bioactive grade guide → View ActiBioPure™ grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.