Recombinant Human CD47 Protein, >95% (SDS-PAGE)

Cat. No.: rp144028
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q08722
Protein Tag
C-hFc
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized human B7-H7/HHLA2 Protein at 10 μg/mL can bind Recombinant Human CD47 Protein (rp144028), the EC50 of human CD47 Protein is 50.0 - 200.0 ng/mL. 2. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CD47 Protein (rp144028) at 1 μg/mL can bind Magrolimab (anti-CD47) (Ab169323) with the EC50 of 10.34 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp144028-10μg
8
139,90US$
50μg
rp144028-50μg
2
309,90US$
100μg
rp144028-100μg
3
495,90US$
1mg
rp144028-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.199,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,Fc tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity
>95% (SDS-PAGE)
Endotoxin level
<1.0 EU/μg
Function
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.

Specifications

Product Name
Recombinant Human CD47 Protein, >95% (SDS-PAGE)
Sinónimos
antigen identified by monoclonal 1D8 | Antigenic surface determinant protein OA3 | CD47 antigen (Rh-related antigen, integrin-associated signal transducer) | CD47 antigen | CD47 glycoprotein | CD47 molecule | CD47 | IAP | IAPintegrin associated protein |
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, Fc tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, Fc tag, ≥95%(SDS-PAGE)
Pureza
>95% (SDS-PAGE)
Bioactividad
1. Measured by its binding ability in a functional ELISA. Immobilized human B7-H7/HHLA2 Protein at 10 μg/mL can bind Recombinant Human CD47 Protein (rp144028), the EC50 of human CD47 Protein is 50.0 - 200.0 ng/mL. 2. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CD47 Protein (rp144028) at 1 μg/mL can bind Magrolimab (anti-CD47) (Ab169323) with the EC50 of 10.34 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Especie
Human
Aminoácidos
19-139 aa
Secuencia
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPALEVLFQGPEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Etiqueta proteínica
C-Fc
Número de adhesión
Peso molecular previsto
40.7 kDa
SDS-PAGE
59.3 kDa, under reducing conditions; 109.3 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25mg/mL.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Samples are stable for twelve months from date of receipt at -20℃ to -80℃. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human CD47 Protein (rp144028) - Protein Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized human B7-H7/HHLA2 Protein at 10 μg/mL can bind Recombinant Human CD47 Protein (rp144028), the EC₅₀ of human CD47 Protein is 50.0 - 200.0 ng/mL.

Recombinant Human CD47 Protein (rp144028) - ELISA
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CD47 Protein (rp144028) at 1 μg/mL can bind Magrolimab (anti-CD47) (Ab169323) with the EC₅₀ of 10.34 ng/mL. 

Recombinant Human CD47 Protein (rp144028) - SDS-PAGE
3 μg/lane of Recombinant Human CD47 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 59.3 kDa under reducing conditions and 109.3 kDa under non-reducing conditions.

Recombinant Human CD47 Protein (rp144028) - Binding Activity
Immobilized Recombinant Human SIRP alpha/CD172a Protein (rp183642) at 1.0 μg/mL can bind Recombinant Human CD47 Protein (rp144028) with the EC₅₀ of 829.1 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F1101859Certificate of AnalysisMay 19, 2026 rp144028
ZJ23F1101860Certificate of AnalysisMay 19, 2026 rp144028
ZJ23F1101861Certificate of AnalysisMay 19, 2026 rp144028
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.