Recombinant Human CTGF Protein, >90% (SDS-PAGE)

Cat. No.: rp156664

GRADE & PURITY Carrier Free, Azide Free, His Tag, ≥90%(SDS-PAGE)

Expression System

E. coli

Accession #

P29279

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Descripción general

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Connective Tissue Growth Factor (CTGF), also known as CCN2, is a 36-38 kDa member of the CCN (CYR61/CTGF/NOV) family of secreted matricellular proteins. Like other CCN proteins, mature human CTGF consists of IGF-binding protein domain, a vWF-C domain, a TSP-1 domain, and a cysteine knot heparin-binding domain. Human CTGF shares 94% amino acid (aa) sequence identity with mouse and rat CTGF. Alternative splicing generates an additional isoform with a 27 aa deletion within the TSP-1 domain. CTGF promotes cell adhesion through interactions with a range of cell surface molecules including heparan sulfate proteoglycans (HSPG), LRPAP, and Integrins alpha M, alpha V beta 3, alpha 6 beta 1, alpha IIb beta 3. It also binds to and regulates signaling through the Wnt receptors LRP6 and Frizzled-8 and the NGF receptors TrkA and NGF R. In addition, CTGF binds directly to BMP-4, TGF-beta 1, TGF-beta 2, and VEGF 165. It blocks BMP-4 and VEGF induced responses but enhances TGF-beta induced responses. Within VEGF complexes, CTGF can be degraded by a variety of proteases, resulting in restoration of angiogenic activity. CTGF promotes fibroblast differentiation from mesenchymal stem cells and their production of type I Collagen and Tenascin C. It promotes chondrocyte proliferation and cartilage matrix synthesis. CTGF is expressed in vascular mural and endothelial cells (EC) during development and promotes pericyte-EC association and angiogenesis. It is expressed in the cerebral cortex and olfactory bulb and plays an important role in nervous system development.

Specifications

Product Name

Recombinant Human CTGF Protein, >90% (SDS-PAGE)

Sinónimos

CCN2 | CCN2IGFBP-8 | connective tissue growth factor | CTGF | CTGRP | Fisp12 | HCS24 | Hypertrophic chondrocyte-specific protein 24 | IBP-8 | IGF-binding protein 8 | IGFBP-8 | IGFBP8CCN family member 2 | Insulin-like growth factor-binding protein 8 | MGC1

Grado

Azide Free, Carrier Free, His Tag

Especificaciones y pureza

Carrier Free, Azide Free, His-Tag, ≥90%(SDS-PAGE)

Pureza

>90% (SDS-PAGE)

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Aminoácidos

253-349 aa

Secuencia

MGHHHHHHGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Etiqueta proteínica

N-His

Número de adhesión

P29279

Peso molecular previsto

12.1 kDa

SDS-PAGE

12.0 and 25.7 kDa, under reducing conditions.

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human CTGF Protein (rp156664)

Recombinant Human CTGF Protein (rp156664) - SDS-PAGE
1 μg/lane of Recombinant Human CTGF Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing the band at 12.0 & 25.7 kDa under reducing conditions.