Recombinant Human Granzyme B Protein

Cat. No.: rp181293
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P10144
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human Granzyme B Protein (rp181293) at 1.0 μg/mL can bind Granzyme B Antibody (Ab106347) with the EC50 of 1.923 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp181293-10μg
6
239,90US$
50μg
rp181293-50μg
5
699,90US$
100μg
rp181293-100μg
5
999,90US$
1mg
rp181293-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.799,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Granzyme B, also known as GZMB, is the most prominent member of the granzyme family of cell death-inducing serine proteases expressed in the granules of cytotoxic T lymphocytes (CTLs) and NK cells. Granzyme B enters the target cells depending on another membrane-binding granule protein, perforin, results in the activation of effector caspases and mitochondrial depolarization through caspase-dependent and -independent pathways, and consequently induces rapid cell apoptosis. Over 3 substrates of GZMB have been identified including the key substrate caspase-3, ICAD, and Bid. GZMB is suggested to protect the host by lysing cells bearing on their surface 'nonself' antigens such as bacterial and viral infected-cells and tumor cells and accordingly plays an essential role in immunosurveillance.

Specifications

Product Name
Recombinant Human Granzyme B Protein
Sinónimos
CCPI | CGL1 | CGL-1 | CSPB | CSP-B | CTLA1 | CTLA-1 | CTSGL1 | Fragmentin-2 | Granzyme B | Granzyme-2 | GranzymeB | GRB | C11 | GrzB | GZMB | HLP | SECT
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactividad
Immobilized Recombinant Human Granzyme B Protein (rp181293) at 1.0 μg/mL can bind Granzyme B Antibody (Ab106347) with the EC50 of 1.923 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-247 aa
Secuencia
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRYHHHHHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
26.9 kDa
SDS-PAGE
34.6 kDa, under reducing conditions; 34.6 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human Granzyme B Protein (rp181293) - ELISA
Immobilized Recombinant Human Granzyme B Protein (rp181293) at 1.0 μg/mL can bind Granzyme B Antibody (Ab106347) with the EC₅₀ of 1.923 ng/mL.

Recombinant Human Granzyme B Protein (rp181293) - SDS-PAGE
3 μg/lane of Recombinant Human Granzyme B Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 34.6 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0707702Certificate of AnalysisFeb 24, 2026 rp181293
ZJ24F0707703Certificate of AnalysisFeb 24, 2026 rp181293
ZJ24F0707704Certificate of AnalysisFeb 24, 2026 rp181293
ZJ24R0600680Certificate of AnalysisJun 14, 2024 rp181293
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.