Recombinant Human IL-1 alpha/IL-1F1 Protein

Cat. No.: rp156178
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P01583
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human IL-1 alpha Protein (rp156178) at 1.0 μg/mL can bind Bermekimab (anti-IL-1a) (Ab175470) with the EC50 of 3.7 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp156178-10μg
10
157,90US$
50μg
rp156178-50μg
7
415,90US$
100μg
rp156178-100μg
7
665,90US$
1mg
rp156178-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.387,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Protein Function:
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Specifications

Product Name
Recombinant Human IL-1 alpha/IL-1F1 Protein
Sinónimos
FAF | BAF | Hematopoietin 1 | Hematopoietin-1 | IL 1 alpha | IL 1A | IL-1 alpha | Il-1a | IL1 | IL1 ALPHA | IL1A | IL1A_HUMAN | IL1F1 | Interleukin 1 alpha | Interleukin-1 alpha | Interleukin1 alpha | LAF | LEM | Preinterleukin 1 alpha | Pro interleukin 1
Grado
ActiBioPure™, Bioactive, Carrier Free, PBS Only
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, PBS Only, ≥95%(SDS-PAGE)
Bioactividad
Immobilized Recombinant Human IL-1 alpha Protein (rp156178) at 1.0 μg/mL can bind Bermekimab (anti-IL-1a) (Ab175470) with the EC50 of 3.7 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
113-271 aa
Secuencia
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
18.0 kDa
SDS-PAGE
15.3 kDa, under reducing conditions; 15.3 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human IL-1 alpha/IL-1F1 Protein (rp156178) - ELISA
Immobilized Recombinant Human IL-1 alpha/IL-1F1 Protein (rp156178) at 1.0 μg/mL can bind Bermekimab (anti-IL-1a) (Ab175470) with the EC₅₀ of 3.70 ng/mL.

Recombinant Human IL-1 alpha/IL-1F1 Protein (rp156178) - SDS-PAGE
3 μg/lane of Recombinant Human IL-1 alpha/IL-1F1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15.3 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0709119Certificate of AnalysisMar 13, 2026 rp156178
ZJ24F0709120Certificate of AnalysisMar 13, 2026 rp156178
ZJ24F0709121Certificate of AnalysisMar 13, 2026 rp156178
ZJ24R0700832Certificate of AnalysisJul 26, 2024 rp156178
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.