Recombinant Human IL-33 Protein, >95%(SDS-PAGE)

Cat. No.: rp169652
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
O95760
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized human IL-33 (rp169652) at 2 μg/mL can bind Etokimab (anti-IL-33) (Ab170468) with the EC50 of 20.97 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp169652-10μg
≥10
175,90US$
50μg
rp169652-50μg
10
619,90US$
100μg
rp169652-100μg
9
859,90US$
1mg
rp169652-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.799,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,Azide Free,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Azide Free,Bioactive,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Interleukin 33 (IL-33), also known as DVS27 or NF-HEV (Nuclear Factor from High Endothelial Venules), is a pro-inflammatory protein and a chromatin-associated cytokine of the IL-1 family with high sequence and structural similarity to IL-1 and IL-18. IL-33 protein is expressed highly and rather selectively by high endothelial venule endothelial cells (HEVECs) in human tonsils, Peyer's patches, and lymph nodes. IL-33 protein has transcriptional regulatory properties, and the researches suggested that IL-33 is a dual-function protein that might act both as a cytokine and as an intracellular nuclear factor. As a type 2 cytokines, IL-33 protein also play a pivotal role in helminthic infection and allergic disorders.

Specifications

Product Name
Recombinant Human IL-33 Protein, >95%(SDS-PAGE)
Sinónimos
C9orf26 | C9orf26chromosome 9 open reading frame 26 (NF-HEV) | DKFZp586H0523 | DVS27 | DVS27-related protein | IL1F11 | IL-1F11 | IL33 | IL-33 | interleukin 33 | Interleukin-1 family member 11 | interleukin-33 | NFHEV | NF-HEV | NF-HEVNFEHEV | Nuclear fac
Grado
ActiBioPure™, Azide Free, Bioactive, Carrier Free, PBS Only
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, Azide Free, PBS Only, ≥95%(SDS-PAGE)
Pureza
>95%(SDS-PAGE)
Bioactividad
Measured by its binding ability in a functional ELISA. Immobilized human IL-33 (rp169652) at 2 μg/mL can bind Etokimab (anti-IL-33) (Ab170468) with the EC50 of 20.97 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
112-270 aa
Secuencia
GPSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
18.1 kDa
SDS-PAGE
16.3 kDa, reducing conditions; 16.3 kDa, non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human IL-33 Protein (rp169652) - ELISA
Measured by its binding ability in a functional ELISA. Immobilized human IL-33 (rp169652) at 2 μg/mL can bind Etokimab (anti-IL-33) (Ab170468) with the EC₅₀ of 20.97 ng/mL.

Recombinant Human IL-33 Protein (rp169652) - SDS-PAGE
2 μg/lane of Recombinant Human IL-33 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.3 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0102686Certificate of AnalysisFeb 05, 2024 rp169652
ZJ24F0102687Certificate of AnalysisFeb 05, 2024 rp169652
ZJ24F0102688Certificate of AnalysisFeb 05, 2024 rp169652
ZJ24R0100236Certificate of AnalysisJan 29, 2024 rp169652
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.