Proteína humana recombinante IL-6R alfa

Cat. No.: rp181252
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P08887
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 2.0 μg/mL can bind Recombinant Human IL-6 Protein (rp156005) with the EC50 of 43.35 ng/mL. 2. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Vobarilizumab (anti-IL-6Ra) (Ab175700) with the EC50 of 67.99 ng/mL. 3. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Tocilizumab (anti-IL-6R) (T412004) with the EC50 of 21.05 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp181252-10μg
7
139,90US$
50μg
rp181252-50μg
4
399,90US$
100μg
rp181252-100μg
4
699,90US$
1mg
rp181252-1mg
1
4.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, bioactivo, sin animales, sin portador, ≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Conservar a -20°C,Evitar la congelación y descongelación repetidas Ships Hielera + almohadillas de hielo Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Pureza: ≥95%, por SDS-PAGE visualizado con tinción azul Coomassie®.
Función de la proteína:
El factor multifuncional interleucina 6 (IL-6) ejerce sus actividades a través de la unión a un complejo receptor de alta afinidad formado por dos glicoproteínas de membrana: un receptor componente de 80 kDa que se une a la IL-6 con baja afinidad (IL-6R alfa ) y un componente de 130 kDa que transduce señales (gp130) que no se une a la IL-6 por sí mismo, pero que es necesario para la unión de alta afinidad de la IL-6 por el complejo. Ambos componentes del complejo receptor, IL-6R alfa y gp130, han sido clonados, secuenciados y expresados.
Se ha encontrado una forma soluble del IL-6R alfa en la orina de humanos adultos sanos. Este receptor soluble parece proceder de la escisión proteolítica del IL-6R alfa unido a la membrana. No se ha descrito ningún ARNm natural que codifique una forma truncada del IL-6R alfa. Sin embargo, se han construido formas solubles de IL-6R alfa humanos y murinos mediante la inserción de codones de terminación en las regiones de los ADNc de IL-6R alfa que codifican las porciones externas de los receptores y antes de los dominios transmembrana. Estos receptores solubles se han expresado en células COS-7 y CHO y se ha demostrado que se unen a la IL-6 en solución y que aumentan la actividad de la IL-6 como resultado de la unión del complejo IL-6/IL-6R alfa a la gp130 unida a la membrana

Specifications

Product Name
Proteína humana recombinante IL-6R alfa
Sinónimos
CD126 antigen | gp80 | IL 6R | IL 6R 1 | IL 6R alpha | IL-6 receptor alpha chain | IL-6 receptor subunit alpha | IL-6R 1 | IL-6R subunit alpha | IL-6R-alpha | IL-6RA | IL6Q | Il6r | CD126 | IL6RA | IL6RA_HUMAN | IL6RQ | Interleukin 6 receptor | interleuki
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
ActiBioPure™, bioactivo, sin animales, sin portador, ≥95%(SDS-PAGE)
Bioactividad
1. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 2.0 μg/mL can bind Recombinant Human IL-6 Protein (rp156005) with the EC50 of 43.35 ng/mL. 2. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Vobarilizumab (anti-IL-6Ra) (Ab175700) with the EC50 of 67.99 ng/mL. 3. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Tocilizumab (anti-IL-6R) (T412004) with the EC50 of 21.05 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-365 aa
Secuencia
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPHHHHHH
Etiqueta proteínica
C-His
Secuencia N-terminal
Leu20
Número de adhesión
Peso molecular previsto
39.4 kDa
SDS-PAGE
60.0-80.8 kDa, under reducing conditions; 60.0-80.7kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Conservar a -20°C,Evitar la congelación y descongelación repetidas
Enviado en
Hielera + almohadillas de hielo
Estabilidad y almacenamiento
Conservar a -20°C durante 1 año. Evitar el ciclo de congelación/descongelación.
Imágenes

Recombinant Human IL-6R alpha Protein (rp181252) - Binding Activity
Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 2.0 μg/mL can bind Recombinant Human IL-6 Protein (rp156005) with the EC₅₀ of 43.35 ng/mL.

Recombinant Human IL-6R alpha Protein (rp181252) - ELISA
Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Vobarilizumab (anti-IL-6Ra) (Ab175700) with the EC₅₀ of 67.99 ng/mL.


Recombinant Human IL-6R alpha Protein (rp181252) - ELISA
Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Tocilizumab (anti-IL-6R) (T412004) with the EC₅₀ of 21.05 ng/mL.

Recombinant Human IL-6R alpha Protein (rp181252) - SDS-PAGE
2 μg/lane of Recombinant Human IL-6R alpha Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 60.0-80.8 kDa under reducing conditions and 60.0-80.7 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0708062Certificate of AnalysisFeb 24, 2026 rp181252
ZJ24F0708063Certificate of AnalysisFeb 24, 2026 rp181252
ZJ24F0708064Certificate of AnalysisFeb 24, 2026 rp181252
ZJ24F0708065Certificate of AnalysisFeb 24, 2026 rp181252
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.