Recombinant Human IL-6R Protein, >90% (SDS-PAGE)

Cat. No.: rp147628
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
P08887
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Immobilized Recombinant Human IL-6 Protein at 2 μg/mL can bind Recombinant Human IL-6R Protein (rp147628) the EC50 is 8.0 - 24.0 ng/mL. 2. Measured by its ability to enhance the IL-6 activity on M1 mouse myeloid leukemia cells. The ED50 for this effect is typically 10.0 - 60.0 ng/mL.3. Using the Octet RED System, the affinity constant (Kd) of Recombinant Human IL-6R Protein (rp147628) bound Anti-IL6R Antibody was 0.1 nM.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp147628-10μg
9
111,90US$
50μg
rp147628-50μg
4
369,90US$
100μg
rp147628-100μg
1
619,90US$
1mg
rp147628-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.299,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Function:
Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.
Low concentration of a soluble form of IL6 receptor acts as an agonist of IL6 activity.


Specifications

Product Name
Recombinant Human IL-6R Protein, >90% (SDS-PAGE)
Sinónimos
CD126 | gp80 | IL-6 R alpha | IL6Q | IL6R alpha | IL-6R alpha | IL6R | IL-6R-1 | IL6RA | IL-6Ra | IL6RQ | interleukin 6 receptor | HIES5 | IL-6R | IL-1Ra | IL6QTL
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥90%(SDS-PAGE)
Pureza
>90% (SDS-PAGE)
Bioactividad
1. Immobilized Recombinant Human IL-6 Protein at 2 μg/mL can bind Recombinant Human IL-6R Protein (rp147628) the EC50 is 8.0 - 24.0 ng/mL. 2. Measured by its ability to enhance the IL-6 activity on M1 mouse myeloid leukemia cells. The ED50 for this effect is typically 10.0 - 60.0 ng/mL.3. Using the Octet RED System, the affinity constant (Kd) of Recombinant Human IL-6R Protein (rp147628) bound Anti-IL6R Antibody was 0.1 nM.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Especie
Human
Aminoácidos
20-365 aa
Secuencia
LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPAHHHHHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
40 kDa
SDS-PAGE
71.1 kDa, under reducing conditions; 68.4 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25mg/mL.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Samples are stable for twelve months from date of receipt at -20℃ to -80℃. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human IL-6R Protein (rp147628) - Protein Bioactivity
Immobilized Recombinant Human IL-6 Protein at 2 μg/mL can bind Recombinant Human IL-6R Protein (rp147628) the EC₅₀ is 8.0 - 24.0 ng/mL.

Recombinant Human IL-6R Protein (rp147628) - Protein Bioactivity
Measured by its ability to enhance the IL-6 activity on M1 mouse myeloid leukemia cells. The ED₅₀ for this effect is typically 10.0 - 60.0 ng/mL.

Recombinant Human IL-6R Protein (rp147628) - BLI Assay
Using the Octet RED System, the affinity constant (Kd) of Recombinant Human IL-6R Protein (rp147628) bound Anti-IL6R Antibody was 0.1 nM.

Recombinant Human IL-6R Protein (rp147628) - SDS-PAGE
3 μg/lane of Recombinant Human IL-6R Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 71.1 kDa under reducing conditions and 68.4 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0505980Certificate of AnalysisMay 24, 2024 rp147628
ZJ24F0505981Certificate of AnalysisMay 24, 2024 rp147628
ZJ24F0505982Certificate of AnalysisMay 24, 2024 rp147628
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.