Recombinant Human KGF Protein, CAS No.148348-15-6

CAS: 148348-15-6 Cat. No.: rp155960 Peso molecular: 19.0 kD Número EC: 621-562-9
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE)
Expression System
Oryza sativa
Accession #
P21781.1
Protein Tag
No tag
Expression system
Oryza sativa
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured in a cell proliferation assay using MCF7 breast cancer cell line. The ED₅₀ for this effect is typically <10 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp155960-10μg
1
189,90US$
50μg
rp155960-50μg
1

508,90US$

619,90US$
Guardar 111,00 US$ (17.91%)
100μg
rp155960-100μg
2
999,90US$
1mg
rp155960-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,≥95%(SDS-PAGE) ActiBioPure™,Azide Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Keratinocyte growth factor (KGF) is a cytokine found by Rubin et al. (1989) from the culture supernatant of embryonic lung fibroblasts, which is a member of the FGF family, namely FGF-7. KGF is an effective epithelial-specific growth factor secreted by mesenchymal cells and distributed in epithelial cells. Its mitotic activity is mainly manifested in keratinocytes, which can specifically promote the proliferation, migration and differentiation of epithelial cells. It is closely related to organ development, wound repair, tumor genesis and immune reconstruction.
Activity definition: The ED50 value is less than 1.0 ng/ml, that is, the corresponding activity unit is greater than or equal to 1 x 10*6 units/mg, as determined by the proliferation method of cultured MCF-7 cells.

Specifications

Product Name
Recombinant Human KGF Protein, CAS No.148348-15-6
Sinónimos
FGF7 | FGF-7 | fibroblast growth factor 7HBGF-7 | HBGF7 | HBGF-7 | Heparin-binding growth factor 7 | keratinocyte growth factor | KGF | KGFfibroblast growth factor 7 (keratinocyte growth factor)
Grado
ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, ≥95%(SDS-PAGE)
Bioactividad
Measured in a cell proliferation assay using MCF7 breast cancer cell line. The ED₅₀ for this effect is typically <10 ng/mL.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
Oryza sativa
Especie
Human
Aminoácidos
32-194 aa
Secuencia
MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLP MAIT
Etiqueta proteínica
No tag
Número de adhesión
Fuente
Rice seed
Peso molecular previsto
19.0 kD
CAS
148348-15-6
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
It is recommended to re dissolve OsrhKGF freeze-dried powder to 100-200 ug/ml with sterile water, and further dilute it with other solvents. The dissolved OsrhKGF can be stored for 2-7 days at 4 ℃ and used up as soon as possible. If it is not used for a short time, please store it at - 20 ℃. After opening, please use it as soon as possible to avoid pollution.
Condiciones de almacenamiento de almacenamiento
Store at -20°C
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Shipped at 4°C. Store at +4°C short term (2-7 days). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Resolution: It is recommended to redissolve lyophilized powder with sterile water to 100-200 ug/ml, and further dilute it with other so
Imágenes

Recombinant Human KGF Protein (rp155960)-Protein Bioactivity
Measured in a cell proliferation assay using MCF7 breast cancer cell line. The ED₅₀ for this effect is typically <10ng/mL.

Recombinant Human KGF Protein (rp155960)-SDS-PAGE
2μg/lane of Recombinant Human KGF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16kDa. Another band is the HSA protein.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F0300074Certificate of AnalysisMay 19, 2026 rp155960
ZJ23F0300075Certificate of AnalysisMay 19, 2026 rp155960
ZJ23F0300079Certificate of AnalysisMay 19, 2026 rp155960
ZJ25F0319986Certificate of AnalysisFeb 24, 2026 rp155960
ZJ25F0319987Certificate of AnalysisFeb 24, 2026 rp155960
ZJ25F0319988Certificate of AnalysisFeb 24, 2026 rp155960
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.