Recombinant Human Leptin Protein, >97%(SDS-PAGE and HPLC)

Cat. No.: rp148245
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥97%(SDS-PAGE&HPLC)
Expression System
E.coli
Accession #
P41159
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human Leptin R transfected BaF3 murine proB cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
100μg
rp148245-100μg
2
69,90US$
200μg
rp148245-200μg
1
118,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity

>97% SDS-PAGE. Recombinant human Leptin was overexpressed as insoluble protein aggregate in E.coli and purified by FPLC gel-filtration chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.


Function

May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.

Specifications

Product Name
Recombinant Human Leptin Protein, >97%(SDS-PAGE and HPLC)
Sinónimos
FLJ94114 | LEP | Leptin (murine obesity homolog) | Leptin (obesity homolog, mouse) | Leptin | OB | Obese protein | obese, mouse, homolog of | Obesity factor | OBOBS | LEP_HUMAN | LEPD | Leptin Murine Obesity Homolog | Leptin Precursor Obesity Factor | Obe
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Especificaciones y pureza
ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC)
Pureza
>97%(SDS-PAGE and HPLC)
Bioactividad
Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human Leptin R transfected BaF3 murine proB cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E.coli
Especie
Human
Aminoácidos
22-167 aa
Secuencia
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Etiqueta proteínica
No tag
Longitud de la proteína
Protein Fragment
Número de adhesión
Fuente
Recombinant
Peso molecular previsto
16 kDa
Nota
This product is about to be sold out and discontinued. The replacement product is rp170412
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconst
Imágenes

Recombinant Human Leptin Protein (rp148245)-Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by a chemotaxis bioassay using human Leptin R transfected BaF3 murine proB cells is less than 2 ng/mL, corresponding to a specific activity of > 5.0×10⁵ IU/mg

Recombinant Human Leptin Protein (rp148245)-SDS-PAGE
Recombinant Human Leptin Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a single band at 16.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F0600320Certificate of AnalysisJun 17, 2026 rp148245
ZJ23F0600321Certificate of AnalysisJun 17, 2026 rp148245
ZJ23F0600325Certificate of AnalysisMar 26, 2024 rp148245
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.