ProTx II,TFA, CAS No.484598-36-9(free base)

CAS: 484598-36-9(free base) Cat. No.: P288852 분자식: C168H250N46O41S8(free base) 분자량: 3826.59(free base)
주문 가능
GRADE & PURITY ≥95%
★
Size
USA
독일 (EU)*
Price
Qty
1mg
P288852-1mg
주문제작 · 8~12주
US$1,599.90
5mg
P288852-5mg
주문제작 · 8~12주
US$3,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

≥95% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Protected from light,Store at -20°C,Argon charged Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
ProTx II,TFA, CAS No.484598-36-9(free base)
사양 및 순도
≥95%
시퀀스
YCQKWMWTCDSERKCCEGMVCRLWCKKKLW(Modifications: Disulfide bridge: 2-16, 9-21, 15-25)
CAS
484598-36-9(free base)
분자 유형
Peptide
보관 및 배송
보관 조건
Protected from light,Store at -20°C,Argon charged
배송
Ice chest + Ice pads

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

인증서(CoA, COO, BSE/TSE 및 분석 차트)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
솔루션 계산기
리뷰

고객 리뷰

자주 묻는 질문

What is the purity of this product?
This product is supplied at ≥95% purity (chemical assay). Lot-specific values are stated on the Certificate of Analysis.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What are the CAS number, molecular formula and molecular weight?
The CAS Number is 484598-36-9(free base).
How should this product be stored?
Store at ?20 °C, protected from light, under argon. It is supplied under an argon blanket; reseal under inert gas after each use.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.