Recombinant Human IL-17F Protein, >95%(SDS-PAGE, HPLC)

Cat. No.: rp147435
주문 가능
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE)
Accession #
Q96PD4
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 20 ng/ml, corresponding to a specific activity of > 5.0 × 104 IU/mg.
Size
USA
독일 (EU)*
Price
Qty
10μg
rp147435-10μg
2 재고 있음
US$142.90
50μg
rp147435-50μg
1 재고 있음
US$351.90
100μg
rp147435-100μg
1 재고 있음
US$671.90
1mg
rp147435-1mg
US 주문제작 · 2–4주 ·
US$5,199.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

개요

Purity
>95% by SDS-PAGE and HPLC analyses.

Function
Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover (PubMed:11591732, PubMed:11591768, PubMed:11574464). Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis (PubMed:11591732). Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation.

Specifications

Product Name
Recombinant Human IL-17F Protein, >95%(SDS-PAGE, HPLC)
동의어
Cytokine ML-1 | IL17F | IL-17F | IL-17Finterleukin-17F | interleukin 17F | ML1 | ML-1 | IL17A | CANDF6 | Cytokine ML-1 | IL-17F
등급
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
사양 및 순도
ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
순도
>95%(SDS-PAGE, HPLC)
생체 활성
Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 20 ng/ml, corresponding to a specific activity of > 5.0 × 104 IU/mg.
내독소 농도
<1.0 EU/μg
표현식 시스템
E.coli
Human
아미노산
31-163 aa
시퀀스
MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
단백질 태그
No tag
가입 번호
예상 분자량
30.1 kDa
SDS-PAGE
16.4 kDa, under reducing conditions.
분자 유형
Protein
보관 및 배송
모양
Lyophilized
재구성
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 6 mM HCl to a concentration of 0.1mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
보관 조건
Store at -20°C,Avoid repeated freezing and thawing
배송
Ice chest + Ice pads
안정성 및 스토리지
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconst
이미지

Recombinant Human IL-17F Protein (rp147435)-Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 20 ng/mL, corresponding to a specific activity of > 5.0 × 10⁴ IU/mg.


Recombinant Human IL-17F Protein (rp147435)-SDS-PAGE
Recombinant Human IL-17F Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining. Showing a single band at 16.4 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

인증서(CoA, COO, BSE/TSE 및 분석 차트)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate Type날짜항목
ZJ23F0600463Certificate of AnalysisJun 17, 2026 rp147435
ZJ23F0600464Certificate of AnalysisJun 17, 2026 rp147435
ZJ23F0600465Certificate of AnalysisJun 17, 2026 rp147435
자주 묻는 질문과 기사
솔루션 계산기
리뷰

고객 리뷰

자주 묻는 질문

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.