CA14

설명Carbonic anhydrase 14

Gene and Protein Information

Gene ID23632
Uniprot Accession IDs Q9ULX7 Q5TB24 Q8NCF4
Ensembl ID ENSP00000358107
Symbol CAXiV
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp469479CA14carbonic anhydrase 149598VGNC:9849OMA, EggNOG
Macaque706360CA14carbonic anhydrase 149544Inparanoid, OMA, EggNOG
Mouse23831Car14carbonic anhydrase 1410090MGI:1344341Inparanoid, OMA, EggNOG
Rat791259Car14carbonic anhydrase 1410116RGD:1599277Inparanoid, OMA, EggNOG
Dog100855809CA14carbonic anhydrase 149615VGNC:38609Inparanoid, OMA, EggNOG
Horse100054535CA14carbonic anhydrase 149796VGNC:15962Inparanoid, OMA, EggNOG
Cow509027CA14carbonic anhydrase 149913VGNC:26652Inparanoid, OMA, EggNOG
Pig100153371CA14carbonic anhydrase 149823OMA, EggNOG
Opossum100016752CA14carbonic anhydrase 1413616Inparanoid, OMA, EggNOG
Xenopus100126213ca14carbonic anhydrase 148364XB-GENE-855636Inparanoid, OMA, EggNOG
Zebrafish567897ca14carbonic anhydrase XIV7955ZDB-GENE-051030-57Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.