TRIM44

설명Tripartite motif-containing protein 44

Gene and Protein Information

Gene ID54765
Uniprot Accession IDs Q96DX7 D3DR14 Q96QY2 Q9UGK0
Ensembl ID ENSP00000299413
Symbol DIPB AN3 MC7 DIPB HSA249128
Sequence
MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp451701TRIM44tripartite motif containing 449598VGNC:959OMA, EggNOG
Macaque717072TRIM44tripartite motif containing 449544Inparanoid, OMA, EggNOG
Mouse80985Trim44tripartite motif-containing 4410090MGI:1931835Inparanoid, OMA, EggNOG
Rat362172Trim44tripartite motif-containing 4410116RGD:1304877Inparanoid, OMA
Dog483424TRIM44tripartite motif containing 449615VGNC:47823Inparanoid, OMA, EggNOG
Cow782816TRIM44tripartite motif containing 449913VGNC:36336Inparanoid, OMA, EggNOG
Pig100524974TRIM44tripartite motif containing 449823OMA, EggNOG
Opossum100010124TRIM44tripartite motif containing 4413616OMA, EggNOG
Platypus100076825TRIM44tripartite motif containing 449258Inparanoid, OMA, EggNOG
Xenopustrim44tripartite motif containing 44 [Source:Xenbase;Acc:XB-GENE-955117]8364OMA, EggNOG
Zebrafish793099trim44tripartite motif containing 447955ZDB-GENE-050522-37Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.