🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS CoA Structure
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

CISD1

설명CDGSH iron-sulfur domain-containing protein 1

Gene and Protein Information

Gene ID55847
Uniprot Accession IDs Q9NZ45 Q1X902
Ensembl ID ENSP00000363041
Symbol C10orf70 ZCD1 ZCD1 MDS029 C10orf70 mitoNEET
FamilyBelongs to the CISD protein family.
Sequence
MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp748227CISD1CDGSH iron sulfur domain 19598VGNC:51970OMA, EggNOG
Macaque701716CISD1CDGSH iron sulfur domain 19544Inparanoid, OMA, EggNOG
Mouse52637Cisd1CDGSH iron sulfur domain 110090MGI:1261855Inparanoid, OMA, EggNOG
Rat294362Cisd1CDGSH iron sulfur domain 110116RGD:1309529Inparanoid, OMA, EggNOG
Horse100072162CISD1CDGSH iron sulfur domain 19796OMA, EggNOG
Cow531444CISD1CDGSH iron sulfur domain 19913VGNC:27371Inparanoid, OMA, EggNOG
Pig100520401LOC100520401CDGSH iron-sulfur domain-containing protein 19823Inparanoid, OMA, EggNOG
Opossum100024488CISD1CDGSH iron sulfur domain 113616Inparanoid, EggNOG
PlatypusCISD1CDGSH iron sulfur domain 1 [Source:HGNC Symbol;Acc:HGNC:30880]9258OMA, EggNOG
Chicken423642CISD1CDGSH iron sulfur domain 19031CGNC:1950Inparanoid, OMA, EggNOG
Anole lizard100559354cisd1CDGSH iron sulfur domain 128377Inparanoid, OMA, EggNOG
Xenopus448057cisd1CDGSH iron sulfur domain 18364XB-GENE-973366Inparanoid, OMA, EggNOG
Zebrafish393577cisd1CDGSH iron sulfur domain 17955ZDB-GENE-040426-1162Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.