HIST3H2A

설명Histone H2A type 3

Gene and Protein Information

Gene ID92815
Uniprot Accession IDs Q7L7L0 B2R4S4
Ensembl ID ENSP00000355656
FamilyBelongs to the histone H2A family.
Sequence
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Mouse319162Hist3h2ahistone cluster 3, H2a10090MGI:2448458Inparanoid, OMA, EggNOG
Horse100061017LOC100061017histone H2A type 39796OMA, EggNOG
Cow538911HIST3H2Ahistone cluster 3, H2a9913Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    histone    /    Histone H2A type 3
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    Histone    /    Histone H2A type 3

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.