CNOT4

설명CCR4-NOT transcription complex subunit 4

Gene and Protein Information

Gene ID4850
Uniprot Accession IDs O95628 B7Z6I4 E7ET38 F8VQP3 O95339 O95627 Q8IYM7 Q8NCL0 Q9NPQ1 Q9NZN6
Ensembl ID ENSP00000445508
Symbol NOT4 NOT4 NOT4H CLONE243
Sequence
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp463751CNOT4CCR4-NOT transcription complex subunit 49598VGNC:7368OMA, EggNOG
Macaque708011CNOT4CCR4-NOT transcription complex subunit 49544Inparanoid, OMA, EggNOG
Mouse53621Cnot4CCR4-NOT transcription complex, subunit 410090MGI:1859026Inparanoid, OMA, EggNOG
Rat312227Cnot4CCR4-NOT transcription complex, subunit 410116RGD:1310318Inparanoid, OMA, EggNOG
Dog482708CNOT4CCR4-NOT transcription complex subunit 49615VGNC:39415Inparanoid, OMA, EggNOG
Horse100065026CNOT4CCR4-NOT transcription complex subunit 49796VGNC:16677Inparanoid, OMA, EggNOG
Cow540891CNOT4CCR4-NOT transcription complex subunit 49913VGNC:27519Inparanoid, OMA, EggNOG
Opossum100016711CNOT4CCR4-NOT transcription complex subunit 413616Inparanoid, OMA, EggNOG
Platypus100081604CNOT4CCR4-NOT transcription complex subunit 49258Inparanoid, OMA, EggNOG
Chicken417936CNOT4CCR4-NOT transcription complex subunit 49031CGNC:8877Inparanoid, OMA, EggNOG
Anole lizard100553912cnot4CCR4-NOT transcription complex subunit 428377Inparanoid, OMA, EggNOG
Xenopus594959cnot4CCR4-NOT transcription complex subunit 48364XB-GENE-947788Inparanoid, OMA, EggNOG
Fruitfly34416Cnot4CCR4-NOT transcription complex subunit 47227FBgn0051716Inparanoid, EggNOG
S.cerevisiae856799MOT2CCR4-NOT core ubiquitin-protein ligase subunit MOT24932S000000870Inparanoid, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.