CA5A

설명Carbonic anhydrase 5A, mitochondrial

Gene and Protein Information

Gene ID763
Uniprot Accession IDs P35218 B2RPF2
Ensembl ID ENSP00000309649
Symbol CA5 CA5 CAV CAVA CA5AD GS1-21A4.1
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp468095CA5Acarbonic anhydrase 5A9598VGNC:9075OMA, EggNOG
Mouse12352Car5acarbonic anhydrase 5a, mitochondrial10090MGI:101946Inparanoid, OMA, EggNOG
Rat54233Car5acarbonic anhydrase 5A10116RGD:2243Inparanoid, OMA, EggNOG
Dog609174CA5Acarbonic anhydrase 5A9615VGNC:53312Inparanoid, OMA, EggNOG
Horse100070642CA5Acarbonic anhydrase 5A9796VGNC:49304Inparanoid, OMA, EggNOG
Cow515359CA5Acarbonic anhydrase 5A9913VGNC:50002Inparanoid, OMA, EggNOG
Opossum100025662CA5Acarbonic anhydrase 5A13616Inparanoid, EggNOG
PlatypusCA5Acarbonic anhydrase 5A [Source:HGNC Symbol;Acc:HGNC:1377]9258OMA, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.