CTSS

설명Cathepsin S

Gene and Protein Information

Gene ID1520
Uniprot Accession IDs P25774 B4DWC9 D3DV05 Q5T5I0 Q6FHS5 Q9BUG3
Ensembl ID ENSP00000357981
FamilyBelongs to the peptidase C1 family.
Sequence
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp457277CTSScathepsin S9598VGNC:516OMA, EggNOG
Macaque708080CTSScathepsin S9544OMA, EggNOG
Mouse13040Ctsscathepsin S10090MGI:107341Inparanoid, OMA, EggNOG
Rat50654Ctsscathepsin S10116RGD:621513Inparanoid, OMA
Dog403400CTSScathepsin S9615VGNC:39715Inparanoid, OMA, EggNOG
Horse100054948CTSScathepsin S9796VGNC:16955Inparanoid, OMA, EggNOG
Cow327711CTSScathepsin S9913VGNC:27818Inparanoid, OMA, EggNOG
Pig100153090CTSScathepsin S9823OMA, EggNOG
Opossum100017406CTSScathepsin S13616Inparanoid, OMA, EggNOG
PlatypusCTSScathepsin S [Source:HGNC Symbol;Acc:HGNC:2545]9258OMA, EggNOG
Chicken425657CTSScathepsin S9031CGNC:494Inparanoid, OMA, EggNOG
Anole lizard100560943ctsscathepsin S28377Inparanoid, OMA, EggNOG
Xenopus448203ctsscathepsin S8364XB-GENE-953011Inparanoid, OMA, EggNOG
Zebrafish337572ctss2.2cathepsin S, ortholog 2, tandem duplicate 27955ZDB-GENE-050626-55OMA, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.