🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS CoA Structure
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

DLX3

설명Homeobox protein DLX-3

Gene and Protein Information

Gene ID1747
Uniprot Accession IDs O60479 B3KQL6
Ensembl ID ENSP00000389870
Symbol AI4 TDO
FamilyBelongs to the distal-less homeobox family.
Sequence
MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp455110DLX3distal-less homeobox 39598VGNC:9259OMA, EggNOG
Macaque700831DLX3distal-less homeobox 39544Inparanoid, OMA, EggNOG
Mouse13393Dlx3distal-less homeobox 310090MGI:94903Inparanoid, OMA, EggNOG
Rat287638Dlx3distal-less homeobox 310116RGD:1304875Inparanoid, OMA, EggNOG
Dog491073DLX3distal-less homeobox 39615VGNC:39991Inparanoid, OMA, EggNOG
Horse100146218DLX3distal-less homeobox 39796VGNC:17221Inparanoid, OMA, EggNOG
Cow784366DLX3distal-less homeobox 39913Inparanoid, EggNOG
Pig100516335DLX3distal-less homeobox 39823OMA, EggNOG
Opossum100019196DLX3distal-less homeobox 313616Inparanoid, OMA, EggNOG
Anole lizard100564927dlx3distal-less homeobox 328377Inparanoid, OMA, EggNOG
Zebrafish30585dlx3bdistal-less homeobox 3b7955ZDB-GENE-980526-280Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    Homeobox protein DLX-3
protein    /    nucleic acid binding    /    homeodomain transcription factor    /    Homeobox protein DLX-3
DTO Classes
protein    /    Transcription factor    /    Helix-turn-helix transcription factor    /    Homeodomain transcription factor    /    Homeobox protein DLX-3

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.