REEP2

설명Receptor expression-enhancing protein 2

Gene and Protein Information

Gene ID51308
Uniprot Accession IDs Q9BRK0 Q53EM8 Q9NYF2
Ensembl ID ENSP00000367590
Symbol C5orf19 SGC32445 SPG72 Yip2d C5orf19 SGC32445
FamilyBelongs to the DP1 family.
Sequence
MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp462096REEP2receptor accessory protein 29598VGNC:4145OMA, EggNOG
Macaque716686REEP2receptor accessory protein 29544OMA, EggNOG
Mouse225362Reep2receptor accessory protein 210090MGI:2385070Inparanoid, OMA, EggNOG
Dog100683708REEP2receptor accessory protein 29615VGNC:45461Inparanoid, OMA, EggNOG
Horse100062247REEP2receptor accessory protein 29796VGNC:22288Inparanoid, OMA, EggNOG
Cow532432REEP2receptor accessory protein 29913VGNC:33852Inparanoid, OMA, EggNOG
Pig100520367REEP2receptor accessory protein 29823OMA, EggNOG
OpossumREEP2receptor accessory protein 2 [Source:HGNC Symbol;Acc:HGNC:17975]13616Inparanoid, EggNOG
Chicken771891REEP2receptor accessory protein 29031CGNC:13044Inparanoid, OMA, EggNOG
Anole lizard100558463reep2receptor accessory protein 228377Inparanoid, OMA, EggNOG
Xenopus100037847reep2receptor accessory protein 28364XB-GENE-961347Inparanoid, OMA, EggNOG
Zebrafish568927reep2receptor accessory protein 27955ZDB-GENE-050706-125Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.